PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016462835.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 222aa    MW: 25682.2 Da    PI: 9.8004
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016462835.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.51.5e-271059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    ri+n+s rqvtfskRrng+lKKA+EL +LCda+v +iifsst klye+s+
  XP_016462835.1 10 RIDNSSSRQVTFSKRRNGLLKKAKELAILCDAQVGLIIFSSTEKLYEFSN 59
                    8***********************************************95 PP

2K-box71.42.6e-2481169997
           K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                     +  ++ + +q+e+a L++++++Lq+++R+++Ge+L  L++k+Lq+Le++Le+s++ iR kK+++l+++i+el  k   +++en +L +k
  XP_016462835.1  81 NPVSELKLWQKEAAILRQQLQELQQNHRQVMGEQLYGLTIKDLQNLENRLETSIRGIRMKKEQILHDEIQELSLKGSLMHQENLELFHK 169
                     45677899***************************************************************************999776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.1E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.628161IPR002100Transcription factor, MADS-box
CDDcd002654.86E-43278No hitNo description
SuperFamilySSF554559.42E-32289IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-273859IPR002100Transcription factor, MADS-box
PfamPF014862.0E-2185169IPR002487Transcription factor, K-box
PROSITE profilePS5129713.2386177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSSSRQVT FSKRRNGLLK KAKELAILCD AQVGLIIFSS TEKLYEFSNT  60
SMKSVVERYN KTKDEHHQLQ NPVSELKLWQ KEAAILRQQL QELQQNHRQV MGEQLYGLTI  120
KDLQNLENRL ETSIRGIRMK KEQILHDEIQ ELSLKGSLMH QENLELFHKA FGTRDANEVN  180
GNSSTPYYFT VSREVNAPIH LQLSQSEPHN CETPARVVSN QR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-19276175MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-19276175MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-19276175MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D2e-19276175MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P2e-19181181Myocyte-specific enhancer factor 2B
1tqe_Q2e-19181181Myocyte-specific enhancer factor 2B
1tqe_R2e-19181181Myocyte-specific enhancer factor 2B
1tqe_S2e-19181181Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009606375.11e-165PREDICTED: MADS-box transcription factor 23-like isoform X1
RefseqXP_016462835.11e-165PREDICTED: MADS-box transcription factor 23-like isoform X1
SwissprotQ6EP492e-93MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLK4BCV31e-117K4BCV3_SOLLC; Uncharacterized protein
STRINGSolyc02g091550.1.11e-117(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6792056
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.11e-82AGAMOUS-like 21