PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016461913.1
Common NameNtabSPL2, SPL2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 463aa    MW: 50206.9 Da    PI: 8.3581
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016461913.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.64.8e-40170247178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +CqvegC++dls+akey+r+h+vC+ hsk+p+v+++g+ +rfCqqCsrfh+lsefDe+krsCrrrL++hn+rrrk+q+
  XP_016461913.1 170 RCQVEGCSHDLSSAKEYYRKHRVCDSHSKCPKVIIAGVARRFCQQCSRFHSLSEFDEKKRSCRRRLSDHNARRRKPQQ 247
                     6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.3E-32164232IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.966168245IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.62E-37169250IPR004333Transcription factor, SBP-box
PfamPF031102.1E-30171244IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MEWNAKWDWG NLVMFGSEAA KSPKELQLTD WGVEEDGELD AGSFNLSSGG SGSGSGTGGY  60
VSDVGHGSSI KSSISASTDS SPKEGLKACN FSFDGSSEDL SKKVKLCSRN SPPMEASVGS  120
VEPLIGLKLG KRTFETIGGA KVSSFPEKHV SSAAAAKKTK SSTQNAPTPR CQVEGCSHDL  180
SSAKEYYRKH RVCDSHSKCP KVIIAGVARR FCQQCSRFHS LSEFDEKKRS CRRRLSDHNA  240
RRRKPQQETI QFNSARLSSL FYDSRQPMNL VLNHSQLVQS RAAANSTWES TEETKFSITR  300
GSTPKPERAG STNGLSLLPG IQLSRAVGAH SNVSSCLLLP SKGHTSEVFN RGATESMFNM  360
GTGREFPRAL SLLSTNSWGS SEPETVSLNN PTHANQSSMP EQMMQAIPQG VPLMSCEYWQ  420
GEQPSSDPRD HTLAANSHAG GSFQGIELFK PPFDTDFYLN ALN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-261712441184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1226243KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0727210.0LC072721.1 Nicotiana tabacum NtabSPL2 mRNA for squamosa promoter binding protein spl2, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001312326.10.0squamosa promoter-binding-like protein 12
RefseqXP_016461913.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_016461914.10.0PREDICTED: squamosa promoter-binding-like protein 12
TrEMBLA0A0C5DEV80.0A0A0C5DEV8_TOBAC; SBP-box 2
STRINGXP_009766987.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41292444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.35e-56squamosa promoter binding protein-like 2
Publications ? help Back to Top
  1. Zhang T,Wang J,Zhou C
    The role of miR156 in developmental transitions in Nicotiana tabacum.
    Sci China Life Sci, 2015. 58(3): p. 253-60
    [PMID:25682394]
  2. Han YY,Ma YQ,Li DZ,Yao JW,Xu ZQ
    Characterization and phylogenetic analysis of fifteen NtabSPL genes in Nicotiana tabacum L. cv. Qinyan95.
    Dev. Genes Evol., 2016. 226(1): p. 1-14
    [PMID:26635304]