PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016460867.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 558aa    MW: 63227.8 Da    PI: 6.591
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016460867.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS240.95.2e-741745522374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     ++lL  cA a++ g+++++q+lL  l+elas + d+++Rlaa+ + AL ++l++ +s+ + ++++++ ++ n++    +l  f+++sP++++ + 
  XP_016460867.1 174 EHLLNPCAAAITVGNMNRVQHLLYVLHELASFTCDANHRLAAHGLHALTHHLSSPGSSSS-SVAVTNFASANHKFFRDSLINFNDISPWFRIPNN 267
                     699**************************************************9665555.566666766677777777777************* PP

            GRAS  97 taNqaIleavege...ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.........skeeleetgerLakfAeelgvpfef 178
                     +aN+ +l+ + +    + +Hi+D+++s+G+QWp+Ll++L+ R+ ++pp +R+T++ +  ++               +  ++L  fA+++++++++
  XP_016460867.1 268 VANSSVLQILGERdklKNLHILDIGVSHGVQWPTLLEELTRRSgGPPPLVRLTVITPTIENgefrgtpfvIGPPGYNFSSQLLAFAKAININLQI 362
                     **********999555667************************55666********9766678999888878888999***************** PP

            GRAS 179 nvlvakrledleleeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe..adhns.esFlerflealeyysalfd 269
                     n l    l++l+ + ++ ++ +E+l+++ +++lh+l+   +s ++er+e+L+++k+l+Pk vv++e++  +++ns ++F++ f++ +ey + ++d
  XP_016460867.1 363 NRLDNFPLQNLNSQVINSSSdDETLVICAQFRLHNLH---HSNSNERTELLRILKNLEPKGVVLSENNieCSCNScGDFATSFSRRVEYLWRFLD 454
                     **86669*********98888***************9...67777789*******************93355555269***************** PP

            GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWk 363
                     s+++ +    + r + Er++++ e+ +++++ g++    +e++ekW er++++GF +  ++e+a + a++llrk++ ++++rvee++g++ l Wk
  XP_016460867.1 455 STSVAY----KGRESEERRMMEGEAAKALTNTGEM----NERKEKWCERMRSVGFVKEVFGEDAIDGARALLRKYDsNWEMRVEERDGCVDLWWK 541
                     **9885....77888888888888*********99....88888********************************9999*************** PP

            GRAS 364 drpLvsvSaWr 374
                     ++p+ + S W+
  XP_016460867.1 542 GQPISFSSLWK 552
                     **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.318147531IPR005202Transcription factor GRAS
PfamPF035141.8E-71174552IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MIKHQNSLSY HPSSWFSDTM TIDEPEPNSN SDPISEWLRT LSDVPTFFDE PYNYPEDLNF  60
YGDSWWIPLN QDTHIVNHDI SDNNICTSFN YSSPVNAATS TMPPEPIILD HPQPLDLSKK  120
RKTSGSDHNP KVSRKNQNRQ MNEVDEIKKS TGQKRVTNKS TTNNGNSKEG RWAEHLLNPC  180
AAAITVGNMN RVQHLLYVLH ELASFTCDAN HRLAAHGLHA LTHHLSSPGS SSSSVAVTNF  240
ASANHKFFRD SLINFNDISP WFRIPNNVAN SSVLQILGER DKLKNLHILD IGVSHGVQWP  300
TLLEELTRRS GGPPPLVRLT VITPTIENGE FRGTPFVIGP PGYNFSSQLL AFAKAININL  360
QINRLDNFPL QNLNSQVINS SSDDETLVIC AQFRLHNLHH SNSNERTELL RILKNLEPKG  420
VVLSENNIEC SCNSCGDFAT SFSRRVEYLW RFLDSTSVAY KGRESEERRM MEGEAAKALT  480
NTGEMNERKE KWCERMRSVG FVKEVFGEDA IDGARALLRK YDSNWEMRVE ERDGCVDLWW  540
KGQPISFSSL WKIDSQCK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-3216755281473Protein SHORT-ROOT
5b3h_B1e-3216755227419Protein SHORT-ROOT
5b3h_E1e-3216755227419Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0327360.0EF032736.1 Nicotiana benthamiana nodulation signaling pathway 1-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009600029.10.0PREDICTED: nodulation-signaling pathway 1 protein-like
RefseqXP_016460867.10.0PREDICTED: nodulation-signaling pathway 1 protein-like
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A1S3Z9H40.0A0A1S3Z9H4_TOBAC; nodulation-signaling pathway 1 protein-like
STRINGXP_009600029.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49492139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-131GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]