PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016460756.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 284aa    MW: 32343.3 Da    PI: 7.0619
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016460756.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof106.31.7e-333793359
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                     + lkcprC s ntkfCyynny+ sqPr++Ck+C+r+Wt+GG+lrnvP+Gggr++++
  XP_016460756.1 37 PEPLKCPRCGSINTKFCYYNNYNKSQPRHYCKGCKRHWTEGGTLRNVPLGGGRKNKR 93
                    6789***********************************************977665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-223393IPR003851Zinc finger, Dof-type
PfamPF027014.4E-303992IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.4684094IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104278IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MGLSTKLVSF DDHGLDNLSQ NSLPEPPSIR RQPTPKPEPL KCPRCGSINT KFCYYNNYNK  60
SQPRHYCKGC KRHWTEGGTL RNVPLGGGRK NKRLRPTDPV DHINRMERVT LEMDNQRCPL  120
ISKTVPSSTI RGNITTLDEE KKESDIFYQT LKFPSTSLQF DHTISNFSKR PFNGNYKDIF  180
AGLKLDGNTH FSFSFDTVPC SLSTQTSNVC NEYMGKFDST VEESTITTVM PITSNSDLLS  240
QPWPIPETSN VTENMPSYNW NWNEIDTLST ADLNITWDDL EIKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016460756.10.0PREDICTED: uncharacterized protein LOC107784185
TrEMBLM1C1N11e-106M1C1N1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000577821e-105(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38000.15e-28DNA binding with one finger 4.7