PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016459153.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 365aa    MW: 40175.5 Da    PI: 9.2648
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016459153.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC81.11e-25137180144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgrsrsrk++e
  XP_016459153.1 137 DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHVHRGRSRSRKPVE 180
                     79***************************************987 PP

2QLQ45.52.2e-1667102136
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                     s+F+  Q+q+L+ Q+l+y++++a++PvPpeLl  ++
  XP_016459153.1  67 SYFSLGQWQELELQALIYRHFIAGAPVPPELLHLVK 102
                     789****************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.4E-867103IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166617.67568103IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.0E-1169101IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.141137181IPR014977WRC domain
PfamPF088791.1E-21138180IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MDFNLKQWRN KQHESEEEET PTSSAKIPRD FDSVSDSALP LFVSQPTTKL SDSTTTTPTK  60
FPRMESSYFS LGQWQELELQ ALIYRHFIAG APVPPELLHL VKKSIITSPS SYYFSHPFQH  120
YPHYQQALMQ SGRAAMDPEP GRCRRTDGKK WRCSRDVVAG QKYCERHVHR GRSRSRKPVE  180
IPTPAINGGK LNTSTNVSHQ NLPGHSAATS TPHFSLSLPS PSIHTLHLNQ RPTESKKGPL  240
EAQKDVSADG KSSGQILRQF FDDWPSQLQE VDNVGSNSSS VASATSLSIS MPGNPSSDFS  300
LKLSTGNGYE SSPQVSNVER STWRTSMGGG PLAEALRSST TNSSPTSVLH QLSRGSTSEA  360
SYIST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0139775e-70BT013977.1 Lycopersicon esculentum clone 133022R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009771979.10.0PREDICTED: growth-regulating factor 3-like
RefseqXP_016459153.10.0PREDICTED: growth-regulating factor 3-like
TrEMBLA0A1S3Z4400.0A0A1S3Z440_TOBAC; growth-regulating factor 3-like
TrEMBLA0A1U7WBE90.0A0A1U7WBE9_NICSY; growth-regulating factor 3-like
STRINGXP_009771979.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32832138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.11e-67growth-regulating factor 4