PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016459080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HRT-like
Protein Properties Length: 521aa    MW: 57722.4 Da    PI: 9.9464
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016459080.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like55.21.2e-17273303131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     +CGv+l++GsvC+r+P+ g+KRC+eHKGm++
  XP_016459080.1 273 TCGVALGHGSVCMRPPITGNKRCAEHKGMKV 303
                     7****************************97 PP

2HRT-like44.72.3e-14336365130
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                     iCG+il+ G +C r+P + +KRC eHKG+R
  XP_016459080.1 336 ICGFILDGGAPCARKPFQRNKRCLEHKGRR 365
                     8****************************9 PP

3HRT-like65.95.3e-21422452131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     iCGv+l dGs+C+rqPv gRKRCeeHKGmR+
  XP_016459080.1 422 ICGVHLTDGSFCTRQPVAGRKRCEEHKGMRV 452
                     8*****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd007190.0083989117No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MGDTHRSITV RLKREDCKRT KHDSAFSDWK ILIGPNDWTD YLLGKEGGAE KYRTQNLPNC  60
TSCSGVYELG VAVTRHQAGR EASRLDPDYI VPVYVGKSDN VRTRLQRYGR EGAHLENGCS  120
NSALHDQVNV SASKRAGLFT EAFSRGFSIV YRWAPMNDNK DAEKTESQLL DRFDYAWNKG  180
SNGLRRHNDV LHKLDGISRA TRLPAFVRKL QLSLEKQKGV RIKPCKPLLL ENGSDFHDSF  240
KSTYFLPQIF KFGRSKPRIV SLSSGVNGDP NTTCGVALGH GSVCMRPPIT GNKRCAEHKG  300
MKVNGVNSKL IAEGNSSVIN ESTRPCASRG EENAPICGFI LDGGAPCARK PFQRNKRCLE  360
HKGRRNRGCI SQPVTDKNGQ SLLEYRTYSS NDCHQMLSRR ADTQHPQDFS SCPLINQNHS  420
VICGVHLTDG SFCTRQPVAG RKRCEEHKGM RVKEPISKQL GAEIPSVFAG TAAKSSSGKK  480
HYNVDIPSVS RSPTCGQHCV MVLFAEGNLR KVLKDVGSTK S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009779864.10.0PREDICTED: uncharacterized protein LOC104228998
RefseqXP_016459080.10.0PREDICTED: protein EFFECTOR OF TRANSCRIPTION 2-like
TrEMBLM1D7670.0M1D767_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000838170.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA77412330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.16e-93effector of transcription2