PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016458658.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 320aa    MW: 35878.7 Da    PI: 7.0721
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016458658.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.62.5e-245094145
             WRC  1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45
                    d+epgrCrRtDGKkWRCs+++++++k+CErH++rgr+rsrk++e+
  XP_016458658.1 50 DPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMNRGRNRSRKHVES 94
                    79****************************************986 PP

2QLQ40.67.7e-151738223
             QLQ  2 aFTaaQlqlLksQilAyKyLaa 23
                    +FTa Q+q+L++Q+++yKyL+a
  XP_016458658.1 17 PFTAVQWQELEHQAMIYKYLVA 38
                    9*******************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF088801.1E-91738IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.985094IPR014977WRC domain
PfamPF088792.3E-205193IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MSGTTTRTVA EDGYRPPFTA VQWQELEHQA MIYKYLVAVG YCSYYGKKFD PEPGRCRRTD  60
GKKWRCSKDA YPDSKYCERH MNRGRNRSRK HVESQSTSQS LLTSMSNNAT GSSKISGNFQ  120
ISSSGSLQNM PLYSAAYSEE PNYGSTGMKT QMEPVSYGVD NKAYRYFHGM AVDADEQNFS  180
LEASASMRSL GMGSNADSTW CLTPQLPSNP MVKPKNDTQL LYDSPQTRLP HPFEPVIDAT  240
ISKQQQHCFF VSDIGSPGTV KQEERSMRPF FDEWPTAKES WSNLDDEGSN KNNFSSTQLS  300
ISIPMAPSDF SRSSCSPNDV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754511e-113HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016458658.10.0PREDICTED: growth-regulating factor 4-like isoform X2
TrEMBLA0A1S3Z2Q60.0A0A1S3Z2Q6_TOBAC; growth-regulating factor 4-like isoform X2
STRINGXP_009588672.10.0(Nicotiana tomentosiformis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.14e-35growth-regulating factor 5