PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016458296.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 223aa    MW: 23917.8 Da    PI: 7.6215
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016458296.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP67.43e-21176223148
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                     +C vegC+ dls+akeyhr+h+vC+ hsk+p+v++ g e+rfCqqCsr
  XP_016458296.1 176 CCLVEGCNLDLSSAKEYHRKHRVCHSHSKCPKVIIGGAERRFCQQCSR 223
                     6**********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.0E-21170223IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.743174223IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.89E-20175223IPR004333Transcription factor, SBP-box
PfamPF031107.8E-16177223IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MEWNVKWDWG DLMMFGSEAC GSLKELQLTD WGVDQEGELD RRSFNLSGFG GSVGGYGSDM  60
GRSSSIKSSI SASTDSSPNE TLKASSFTFE ASNGSQGNLG KDVEQCRDEP YGCSPPMEAL  120
IGYDGPLTGL KLGKRTVESN SGGINVKLPS SSTIPVSSVS AAKKKKSSSQ NALIPCCLVE  180
GCNLDLSSAK EYHRKHRVCH SHSKCPKVII GGAERRFCQQ CSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A2e-14176223552squamosa promoter-binding protein-like 12
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016458296.11e-164PREDICTED: squamosa promoter-binding-like protein 2 isoform X2
SwissprotA2YGR55e-31SPL12_ORYSI; Squamosa promoter-binding-like protein 12
TrEMBLA0A1S3Z1F21e-162A0A1S3Z1F2_TOBAC; squamosa promoter-binding-like protein 2 isoform X2
STRINGXP_009796500.11e-162(Nicotiana sylvestris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.33e-27squamosa promoter binding protein-like 2