PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016458252.1
Common NameNTH22
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 319aa    MW: 36622.9 Da    PI: 4.8165
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016458252.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-092632962255
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +yp+++++  LA+++gL+ +q+ +WF N+R ++
  XP_016458252.1 263 WPYPTEADKNSLAESTGLDPKQINNWFINQRKRH 296
                     58*****************************885 PP

2ELK30.86.4e-11216237122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++LlrK++++L++Lk EFs
  XP_016458252.1 216 ELKDRLLRKFGSHLSTLKLEFS 237
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.2E-1986130IPR005540KNOX1
PfamPF037906.2E-2188129IPR005540KNOX1
SMARTSM012562.7E-26136187IPR005541KNOX2
PfamPF037911.2E-24139186IPR005541KNOX2
PfamPF037891.3E-7216237IPR005539ELK domain
SMARTSM011881.1E-5216237IPR005539ELK domain
PROSITE profilePS5121310.057216236IPR005539ELK domain
PROSITE profilePS5007112.908236299IPR001356Homeobox domain
SuperFamilySSF466894.71E-20237310IPR009057Homeodomain-like
SMARTSM003894.2E-14238303IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-28241300IPR009057Homeodomain-like
CDDcd000867.35E-13248300No hitNo description
PfamPF059201.6E-17256295IPR008422Homeobox KN domain
PROSITE patternPS000270274297IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010073Biological Processmeristem maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDDEIYGFHS TSEYADKALM SPENLMMQTE YNMTYHNYNT LSTPPMMFGS DDVQLSSEAA  60
NSENNNIHHQ IRGSCSRRDD TEDASNIIKA KVVSHPFYPK LLRAYIDCQK VGAPPEIATV  120
LEEIRQQNDF RKPNATSICI GADPELDEFM ETYCDILVKY KSDLSRPFDE ATTFLSKIEL  180
QLSNLCKDDG GVSSDEELSC GEVEGQDASQ RSEDNELKDR LLRKFGSHLS TLKLEFSKKK  240
KKGKLPKEAR QMLLAWWNDH YRWPYPTEAD KNSLAESTGL DPKQINNWFI NQRKRHWKPS  300
ENMQLAVMDN LSGQFFSDD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0257150.0AB025715.1 Nicotiana tabacum mRNA for homeobox 22, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016458252.10.0PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS61e-130KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLQ9SXV40.0Q9SXV4_TOBAC; Homeobox 22
STRINGPGSC0003DMT4000350951e-180(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-119KNOTTED1-like homeobox gene 6
Publications ? help Back to Top
  1. Nishimura A,Tamaoki M,Sato Y,Matsuoka M
    The expression of tobacco knotted1-type class 1 homeobox genes correspond to regions predicted by the cytohistological zonation model.
    Plant J., 1999. 18(4): p. 337-47
    [PMID:10406119]