PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016452522.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 246aa    MW: 28689.9 Da    PI: 9.7732
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016452522.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.22.8e-302777151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien++nrqvtf+kRrng+lKKA+ELSvLC+ae+a+i+fss+g++yeys+
  XP_016452522.1 27 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSSRGRVYEYSN 77
                    79***********************************************95 PP

2K-box101.21.4e-33971918100
           K-box   8 s..leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                     +  ++e +a+ +qqe++kL+++i+++q+++Rhl+Ge+L+sL+++eL+qLe++Le+++++iRskK+e++l+++e+lqk+e +l++en  Lr+k++e
  XP_016452522.1  97 ActTQELNAQFYQQESKKLRQQIQMIQNSNRHLVGEGLSSLNVRELKQLENRLERGITRIRSKKHEMILAETENLQKREIQLEQENAFLRSKIAE 191
                     24478899************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.3471979IPR002100Transcription factor, MADS-box
SMARTSM004328.6E-411978IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-322094IPR002100Transcription factor, MADS-box
CDDcd002652.02E-412092No hitNo description
PROSITE patternPS0035002175IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-312141IPR002100Transcription factor, MADS-box
PfamPF003191.8E-252875IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-314156IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-315677IPR002100Transcription factor, MADS-box
PfamPF014861.0E-26101189IPR002487Transcription factor, K-box
PROSITE profilePS5129715.891105195IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MCTKFPLCMR FGEKPDHKMG RGKIEIKRIE NNTNRQVTFC KRRNGLLKKA YELSVLCEAE  60
IALIVFSSRG RVYEYSNNNI KATIDRYKKA TSETSNACTT QELNAQFYQQ ESKKLRQQIQ  120
MIQNSNRHLV GEGLSSLNVR ELKQLENRLE RGITRIRSKK HEMILAETEN LQKREIQLEQ  180
ENAFLRSKIA ENERLQELSM MPTGGQDYSA IQQYLARNML QLNMMEGGIP SYHQLPTDKK  240
SLELHE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-201987169Myocyte-specific enhancer factor 2B
1tqe_Q4e-201987169Myocyte-specific enhancer factor 2B
1tqe_R4e-201987169Myocyte-specific enhancer factor 2B
1tqe_S4e-201987169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX816510.0X81651.1 P.hybrida mRNA for MADS box containing protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016452522.10.0PREDICTED: agamous-like MADS-box protein AGL11
SwissprotQ388363e-99AGL11_ARATH; Agamous-like MADS-box protein AGL11
TrEMBLA0A097BU201e-157A0A097BU20_TOBAC; TAGL11 transcription factor
STRINGPGSC0003DMT4000132481e-145(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.11e-100MIKC_MADS family protein