PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016450421.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HRT-like
Protein Properties Length: 533aa    MW: 59479.9 Da    PI: 10.1026
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016450421.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like52.48.8e-17251281131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     iCGv+l++GsvC r+P+ g+KRC+eHKGm++
  XP_016450421.1 251 ICGVALGHGSVCIRPPIMGNKRCAEHKGMKV 281
                     8****************************97 PP

2HRT-like61.21.5e-19359389131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     +CGv+l+dGs+C+rqP+ gRKRCeeHKGmR+
  XP_016450421.1 359 MCGVHLNDGSFCTRQPAVGRKRCEEHKGMRV 389
                     6*****************************7 PP

3HRT-like50.63.1e-16432461231
        HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     CG++l +Gs+C+r+P +g+KRC++HKGmR+
  XP_016450421.1 432 CGATLCNGSFCRRKPSEGNKRCWQHKGMRV 461
                     *****************************7 PP

4HRT-like50.82.8e-16504532230
        HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                     CG++l++Gs+C+r+P kg+KRC++HKGm+
  XP_016450421.1 504 CGATLRNGSFCRRKPSKGNKRCWQHKGMK 532
                     ****************************8 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MSFIHKGEKI LIGPNDWTNY LLGKEGAEKY RTQNLPNCTS CSGVYELGIA VSRHQAGREA  60
SRLDPDYIVP VYVGKSDIVR TRLQRYGREG AHLENICSNS ALHDQENVSA SKRAGLFTEA  120
FSRGFSIVYR WAPMNDNKDA EKTESQLLDR FDYAWNKGSN GVRRHNDVLH KLDRISRATR  180
LPAFVRKLQL SLEKQKGVKI KACKPLLLEN GSEFHDSFKG TYFLPQIFKF GRSNPRIISL  240
SSGVNGDPNT ICGVALGHGS VCIRPPIMGN KRCAEHKGMK VNGVNSKLIA ECLEHKGRSR  300
GLISQPVTDK SCHWTHNPIL ENRTYSTDDG QQMLSRTADT QHPQDFSSCP LIGKNHKVMC  360
GVHLNDGSFC TRQPAVGRKR CEEHKGMRVK EPISKQLGVE IPSVFAGPAT KISSEKMHWN  420
IDIPSVNHSP ACGATLCNGS FCRRKPSEGN KRCWQHKGMR VKEPISKQLE AEIPSVFAGP  480
ATKISSEKMH WNIDIPSVNH SPACGATLRN GSFCRRKPSK GNKRCWQHKG MKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009593861.10.0PREDICTED: uncharacterized protein LOC104090466 isoform X3
RefseqXP_016450421.10.0PREDICTED: protein EFFECTOR OF TRANSCRIPTION 2-like isoform X2
TrEMBLM1D7670.0M1D767_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000838170.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.11e-74effector of transcription2