PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016450420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HRT-like
Protein Properties Length: 567aa    MW: 63263.1 Da    PI: 10.1102
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016450420.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like52.39.4e-17285315131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     iCGv+l++GsvC r+P+ g+KRC+eHKGm++
  XP_016450420.1 285 ICGVALGHGSVCIRPPIMGNKRCAEHKGMKV 315
                     8****************************97 PP

2HRT-like61.11.6e-19393423131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     +CGv+l+dGs+C+rqP+ gRKRCeeHKGmR+
  XP_016450420.1 393 MCGVHLNDGSFCTRQPAVGRKRCEEHKGMRV 423
                     6*****************************7 PP

3HRT-like50.53.4e-16466495231
        HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     CG++l +Gs+C+r+P +g+KRC++HKGmR+
  XP_016450420.1 466 CGATLCNGSFCRRKPSEGNKRCWQHKGMRV 495
                     *****************************7 PP

4HRT-like50.73.1e-16538566230
        HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                     CG++l++Gs+C+r+P kg+KRC++HKGm+
  XP_016450420.1 538 CGATLRNGSFCRRKPSKGNKRCWQHKGMK 566
                     ****************************8 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MYNSLSEGAK ASSMGATHRS VTVRLNREDC KRTKHDSAFS DWKILIGPND WTNYLLGKEG  60
AEKYRTQNLP NCTSCSGVYE LGIAVSRHQA GREASRLDPD YIVPVYVGKS DIVRTRLQRY  120
GREGAHLENI CSNSALHDQE NVSASKRAGL FTEAFSRGFS IVYRWAPMND NKDAEKTESQ  180
LLDRFDYAWN KGSNGVRRHN DVLHKLDRIS RATRLPAFVR KLQLSLEKQK GVKIKACKPL  240
LLENGSEFHD SFKGTYFLPQ IFKFGRSNPR IISLSSGVNG DPNTICGVAL GHGSVCIRPP  300
IMGNKRCAEH KGMKVNGVNS KLIAECLEHK GRSRGLISQP VTDKSCHWTH NPILENRTYS  360
TDDGQQMLSR TADTQHPQDF SSCPLIGKNH KVMCGVHLND GSFCTRQPAV GRKRCEEHKG  420
MRVKEPISKQ LGVEIPSVFA GPATKISSEK MHWNIDIPSV NHSPACGATL CNGSFCRRKP  480
SEGNKRCWQH KGMRVKEPIS KQLEAEIPSV FAGPATKISS EKMHWNIDIP SVNHSPACGA  540
TLRNGSFCRR KPSKGNKRCW QHKGMKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009593858.10.0PREDICTED: protein EFFECTOR OF TRANSCRIPTION 2 isoform X1
RefseqXP_016450420.10.0PREDICTED: protein EFFECTOR OF TRANSCRIPTION 2-like isoform X1
TrEMBLA0A1S3YDY40.0A0A1S3YDY4_TOBAC; protein EFFECTOR OF TRANSCRIPTION 2-like isoform X1
STRINGXP_009593858.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA77412330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.14e-85effector of transcription2