PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016449892.1
Common NameNtabSPL6-4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 538aa    MW: 58903.7 Da    PI: 8.1969
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016449892.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.22e-42181257278
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     Cqv+gC +dls++k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q+
  XP_016449892.1 181 CQVQGCGKDLSSCKDYHKRHKVCEVHSKTAKVIVKGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQT 257
                     **************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.0E-34175242IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.812178255IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-39179258IPR004333Transcription factor, SBP-box
PfamPF031101.3E-31181254IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MESWSYVSGG KGFVSEETIR CIKLPLCAGS REGPEPKECV SIDDGISLGQ NRTSGWELNT  60
PCSWGNSMGC LSNQEGGEKQ DFAEMGYQDL MRKSLPNNQI KDAMSSKVGG QRSFVSIRVP  120
HNSFSGEDES SSVVESNCKD SSLIDLKLGS FKSPNIIPNL SSTVPAKRNR AGGLSSHTPF  180
CQVQGCGKDL SSCKDYHKRH KVCEVHSKTA KVIVKGIEQR FCQQCSRFHL LAEFDDGKRS  240
CRKRLAGHNE RRRKPQTGLH SGRAGRLFQS YAGTRFQGTP FATSSFICQD ILGSGLLHQP  300
KHDLHDWYKN VKVEHSSDYS PQLTMPFTNG HSQPRPLFST SYHTDKHCPA LHDEGITAIT  360
RSKNNVSSNS YLNDIEGSDF VSRSLFHSTS IGSEVLNVMD LASTFQGISS SGCALSLLSS  420
QSQGSSNYSS VVPNSHHLIA PSDNAHYNVT QTSEKFPGMS LKDSTSNASG IFNISGAISA  480
EGRLEQILRN NCGINGSIHG SDYVNTKNLL SCQDGPTIDL LQLSSQLHRV EHQRHSMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-29175254584squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0732920.0LC073292.1 Nicotiana tabacum NtabSPL6-4 mRNA for squamosa promoter binding protein NtabSPL6-4, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001312117.10.0squamosa promoter-binding-like protein 6
RefseqXP_009615765.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_009615766.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_016449891.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_016449892.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_018630442.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A125SZN10.0A0A125SZN1_TOBAC; Squamosa promoter binding protein NtabSPL6-4
STRINGXP_009615765.10.0(Nicotiana tomentosiformis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-47SBP family protein
Publications ? help Back to Top
  1. Han YY,Ma YQ,Li DZ,Yao JW,Xu ZQ
    Characterization and phylogenetic analysis of fifteen NtabSPL genes in Nicotiana tabacum L. cv. Qinyan95.
    Dev. Genes Evol., 2016. 226(1): p. 1-14
    [PMID:26635304]