PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016449735.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 230aa    MW: 26722.5 Da    PI: 10.2002
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016449735.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.12.3e-281059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    ri+n+s rqvtfskRrng+lKKA+EL +LCda+v +iifsstgklye+s+
  XP_016449735.1 10 RIDNSSSRQVTFSKRRNGLLKKAKELAILCDAQVGLIIFSSTGKLYEFSN 59
                    8***********************************************95 PP

2K-box73.46.7e-2578167998
           K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                     + ++  ++l++e+a L++++++Lq+++R+++Ge+L  L++k+Lq+Le++Le+s++ iR kK+++l+++i+el  k   +++en +L +k+
  XP_016449735.1  78 QLHNPVSELKKEAAMLRQQLQELQQNHRQVMGEQLYGLTIKDLQHLENRLETSIRGIRMKKEQILHDEIQELSWKGSLMHQENLELVQKV 167
                     455557899*******************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.3E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.441161IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.41E-32279IPR002100Transcription factor, MADS-box
CDDcd002651.43E-43276No hitNo description
PRINTSPR004044.9E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.4E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-283859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.64883173IPR002487Transcription factor, K-box
PfamPF014863.9E-2283167IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSSSRQVT FSKRRNGLLK KAKELAILCD AQVGLIIFSS TGKLYEFSNT  60
SMKSIVERYN KTKDERNQLH NPVSELKKEA AMLRQQLQEL QQNHRQVMGE QLYGLTIKDL  120
QHLENRLETS IRGIRMKKEQ ILHDEIQELS WKGSLMHQEN LELVQKVNII QQENVDLYKK  180
AFGTRDANEL NGNSTTPYYF TVSREVHAPI HLQLSQPEPH NFARVVSNQR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-18280175MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-18280175MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-18280175MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-18280175MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J2e-18280175Myocyte-specific enhancer factor 2A
3p57_I2e-18280175Myocyte-specific enhancer factor 2A
3p57_D2e-18280175Myocyte-specific enhancer factor 2A
3p57_C2e-18280175Myocyte-specific enhancer factor 2A
3p57_B2e-18280175Myocyte-specific enhancer factor 2A
3p57_A2e-18280175Myocyte-specific enhancer factor 2A
3kov_J2e-18280175Myocyte-specific enhancer factor 2A
3kov_I2e-18280175Myocyte-specific enhancer factor 2A
3kov_B2e-18280175Myocyte-specific enhancer factor 2A
3kov_A2e-18280175Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754412e-46HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016449735.11e-171PREDICTED: MADS-box transcription factor 27-like isoform X2
SwissprotQ6EP492e-98MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLK4BCV31e-125K4BCV3_SOLLC; Uncharacterized protein
STRINGSolyc02g091550.1.11e-125(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.15e-88AGAMOUS-like 21