PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016449440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 364aa    MW: 41280.8 Da    PI: 8.6581
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016449440.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.85.1e-2578121144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e
  XP_016449440.1  78 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE 121
                     79***************************************986 PP

2QLQ59.69e-211145236
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                    +FTa+Q+q+L++Q+l+yKy+++++PvPp+Ll  i+
  XP_016449440.1 11 PFTANQWQELEHQALIYKYMVSGMPVPPDLLYTIR 45
                    8*****************************97776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.2E-121046IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.2081146IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.6E-161144IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.94178122IPR014977WRC domain
PfamPF088793.4E-2179121IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MMSTAARSRF PFTANQWQEL EHQALIYKYM VSGMPVPPDL LYTIRRSMDS SLSSKLVLHQ  60
PHHIGWNCFQ MGFGKKIDPE PGRCRRTDGK KWRCSKEAYP DSKYCERHMH RGRNRSRKPV  120
EIMTTTSTNT STTTRPISTA TNTTAPTAIS ISSINKNTNN ISSSSPTSSL HSFSYLSSTH  180
EPHQYPFLYP HSSSSRPSPA AIGLESSAYS RNGYGDGMKE DVDEHIFFSE TSGTVRSTCG  240
SNSVDDTWQL SPLTMASPMK QRTYSLSQNT GHSASSYLQL QSLNESSKDH HHQYYNDAKS  300
IKLETEDQQH QPKKVMHHFF DEWPKDNKDS WLDSEDKFSG LSKTQLSISI PNPSHDFFIT  360
TNEK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755198e-81HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767378.10.0PREDICTED: growth-regulating factor 1-like
RefseqXP_016449440.10.0PREDICTED: growth-regulating factor 1-like isoform X2
TrEMBLA0A1S3YB510.0A0A1S3YB51_TOBAC; growth-regulating factor 1-like isoform X2
TrEMBLA0A1U7VLY80.0A0A1U7VLY8_NICSY; growth-regulating factor 1-like
STRINGXP_009767378.10.0(Nicotiana sylvestris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-60growth-regulating factor 5