PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016448073.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 104aa    MW: 11577.1 Da    PI: 4.5982
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016448073.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26041.44.2e-1314161101
          DUF260  61 lvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                     +vyeA+ar+rdPvyG++g i +lq+q+++l+++la++++e+
  XP_016448073.1   1 MVYEANARLRDPVYGCAGAICHLQKQVNELQVQLAKAQAEI 41 
                     69**********************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.41141IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-11138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MVYEANARLR DPVYGCAGAI CHLQKQVNEL QVQLAKAQAE IVNMQCEQAN LMALICMEMT  60
QSPQASPHHY SLGNLTNITY GNSQSNMTFL DDNSFGSFSE TLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754454e-52HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755184e-52HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016448073.16e-74PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR02e-22LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A1S3Y7D41e-72A0A1S3Y7D4_TOBAC; LOB domain-containing protein 1-like
STRINGXP_009610820.14e-70(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.17e-25LOB domain-containing protein 1