PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016447855.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 222aa    MW: 25557.4 Da    PI: 9.6421
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016447855.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.82.2e-31959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien + rqvtfskRrngi+KKA+ELSvLCdaevaviifs++g+lye+ss
  XP_016447855.1  9 KRIENATSRQVTFSKRRNGIMKKAYELSVLCDAEVAVIIFSQKGRLYEFSS 59
                    79***********************************************96 PP

2K-box77.14.6e-2685173997
           K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                       e+++e+l++e a++ k+ie L+ ++R+l+G++++s+s++eLq++ +qLe+slk+iR++K++l++++i++l+ kek+l een++L+++
  XP_016447855.1  85 EVEHHMEHLKEETANIAKKIEILEVSKRKLMGQGIGSCSMNELQEIDSQLERSLKNIRARKTQLFKDKIQRLKAKEKQLLEENERLSEE 173
                     467889********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.366161IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-41160IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-31323IPR002100Transcription factor, MADS-box
CDDcd002652.34E-41378No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.07E-33385IPR002100Transcription factor, MADS-box
PfamPF003193.5E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-313859IPR002100Transcription factor, MADS-box
PfamPF014864.5E-2587174IPR002487Transcription factor, K-box
PROSITE profilePS5129714.42490180IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009838Biological Processabscission
GO:0009909Biological Processregulation of flower development
GO:0010150Biological Processleaf senescence
GO:0080187Biological Processfloral organ senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MVRGKVQMKR IENATSRQVT FSKRRNGIMK KAYELSVLCD AEVAVIIFSQ KGRLYEFSSS  60
SMQKAIGRYR QYTKETLINN NSSLEVEHHM EHLKEETANI AKKIEILEVS KRKLMGQGIG  120
SCSMNELQEI DSQLERSLKN IRARKTQLFK DKIQRLKAKE KQLLEENERL SEECGLRRQP  180
EAPPPPLTRI SQQKETASCS HSVQNSEVET DLFIGLPDIC WS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-21173173Myocyte-specific enhancer factor 2B
1tqe_Q3e-21173173Myocyte-specific enhancer factor 2B
1tqe_R3e-21173173Myocyte-specific enhancer factor 2B
1tqe_S3e-21173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00576DAPTransfer from AT5G62165Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016447855.11e-164PREDICTED: MADS-box protein AGL42-like
RefseqXP_016447856.11e-164PREDICTED: MADS-box protein AGL42-like
SwissprotQ9FIS13e-84AGL42_ARATH; MADS-box protein AGL42
TrEMBLQ9ATE71e-110Q9ATE7_PETHY; MADS-box transcription factor FBP22
STRINGSolyc03g006830.2.14e-92(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.32e-85AGAMOUS-like 42