PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016447733.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 325aa    MW: 37084.9 Da    PI: 9.313
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016447733.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC789.3e-2570113144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e
  XP_016447733.1  70 DPEPGRCRRTDGKKWRCSKEAYADSKYCERHMHRGRNRSRKPVE 113
                     79***************************************997 PP

2QLQ60.93.4e-21943236
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                    +FTa+Q+q+L++Q+l+yKy+a+++PvPp+Ll  i+
  XP_016447733.1  9 PFTATQWQELEHQALIYKYMASGMPVPPDLLYTIR 43
                    9*****************************97776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.9E-12844IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.278944IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.1E-16942IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.65870114IPR014977WRC domain
PfamPF088795.5E-2171113IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MSRARSGYPF TATQWQELEH QALIYKYMAS GMPVPPDLLY TIRRSLDSSN HQPQHIGWNC  60
FQLGFGKKID PEPGRCRRTD GKKWRCSKEA YADSKYCERH MHRGRNRSRK PVEVMTTRTT  120
NTNTTPPTAI TISSIKKNSN NYSPSTPASF SYSSEPQHSF LYPHSSSSRP PGNIGLSSQD  180
QTKFLFDSGA YSRSASGSTS IDDNSWELAP LTMGSPLGHS KQRTYSVSQT GESYLQLQSF  240
NESSRQQQQR QDQYNYYALG NDVKADLHMK IDTEDHQQPK KVMHHFFDEL PPDQHNKDSW  300
LDSKTHLSIS VPDSSRDFFI THNGK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754463e-74HG975446.1 Solanum pennellii chromosome ch07, complete genome.
GenBankHG9755193e-74HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009615805.10.0PREDICTED: growth-regulating factor 1-like
RefseqXP_016447733.10.0PREDICTED: growth-regulating factor 1-like
TrEMBLA0A1S3Y6450.0A0A1S3Y645_TOBAC; growth-regulating factor 1-like
STRINGXP_009615805.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7432384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-54growth-regulating factor 5