PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016447182.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 426aa    MW: 47095 Da    PI: 5.5566
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016447182.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.78.5e-083754082154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp++e++++L +++gL+ +q+ +WF N+R +
  XP_016447182.1 375 KWPYPTEEDKAKLVQETGLQLKQINNWFINQRKR 408
                     569*****************************87 PP

2ELK27.76.3e-10329350122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+++Y+++L+++++E++
  XP_016447182.1 329 ELKHELKQGYKEKLVDIREEIL 350
                     9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.2E-18167211IPR005540KNOX1
PfamPF037906.4E-17169210IPR005540KNOX1
SMARTSM012564.0E-28219274IPR005541KNOX2
PfamPF037911.4E-20223273IPR005541KNOX2
PfamPF037892.2E-6329350IPR005539ELK domain
PROSITE profilePS5121310.144329349IPR005539ELK domain
SMARTSM011889.2E-4329350IPR005539ELK domain
PROSITE profilePS5007111.742349412IPR001356Homeobox domain
SMARTSM003891.8E-11351416IPR001356Homeobox domain
SuperFamilySSF466894.19E-16351415IPR009057Homeodomain-like
CDDcd000867.99E-12352413No hitNo description
Gene3DG3DSA:1.10.10.603.2E-25356413IPR009057Homeodomain-like
PfamPF059201.0E-17369408IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MAYNPNHMSQ EMDMHHFSDE NSAVLRSILP EQLAQSSPDV KPLDHQQPPT WLNSAILRQE  60
SHYTGTGGRG AGENFLNLHS NSESSAAASQ ASNQWLSRSI LQRNVSDVQT SNNSSAVMAA  120
TDLKNDDGNN NNDNGNNNAG GQLTDSEVVG GGGGGGGTDG ILNWQNAGYK AEILAHPLFE  180
QLLSAHVACL RIATPVDQLP RIDAQLAQSQ QVVAKYSSLG QNIGDDKELD QFLTHYVLLL  240
CSFKEQLQQH VRVHAMEAVM ACWEIEQSLQ SLTGVSPGEG TGATMSDDED DQVDSEANLF  300
DGSLDGHDGM GFGLPTESER SLMERVRQEL KHELKQGYKE KLVDIREEIL RKRRAGKLPG  360
DTTSVLKAWW QSHAKWPYPT EEDKAKLVQE TGLQLKQINN WFINQRKRNW HSNPSSSTTS  420
KSKRKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A4e-13352416872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1405425RKRNWHSNPSSSTTSKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0047970.0AB004797.1 Nicotiana tabacum NTH23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009784536.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X3
RefseqXP_009784535.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X2
RefseqXP_009784534.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X1
RefseqXP_016447183.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X2
RefseqXP_016447182.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X1
SwissprotP480000.0KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLO658500.0O65850_TOBAC; NTH23 protein
STRINGPGSC0003DMT4000403510.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14322472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-176KNOTTED1-like homeobox gene 3