PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016447081.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 201aa    MW: 23114.9 Da    PI: 8.7637
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016447081.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.39.5e-24957149
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    krien   rqvtf+kRr+g+lKKA+ELSvLCdae+ + ifs +gk ye 
  XP_016447081.1  9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGLFIFSAHGKRYEL 57
                    79*******************************************9985 PP

2K-box56.51.2e-19831749100
           K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                     ++++++   + e++ Lk eie Lqr +  + G + ++++l eL++Le+ Le  + +iRs K+++++++i+ l++ke  lq +nk+L+ k+ee
  XP_016447081.1  83 AKDKQTLDPKGEINMLKHEIEVLQRGLSYMYGGGAGTMTLDELHSLEKYLELWMFHIRSAKMDMMFQEIQLLKNKEGILQAANKYLQDKIEE 174
                     56677777789******************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.4E-34160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.16E-26173IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.072161IPR002100Transcription factor, MADS-box
CDDcd002659.44E-38278No hitNo description
PRINTSPR004044.3E-26323IPR002100Transcription factor, MADS-box
PfamPF003194.2E-211055IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.78288178IPR002487Transcription factor, K-box
PfamPF014868.2E-2190172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MARGKVQMKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGLFIFSA HGKRYELATK  60
GTMQGLIEKY LKSTRGAEVA EEAKDKQTLD PKGEINMLKH EIEVLQRGLS YMYGGGAGTM  120
TLDELHSLEK YLELWMFHIR SAKMDMMFQE IQLLKNKEGI LQAANKYLQD KIEEQYPVTN  180
MTSTLTDFQC PLTVQNEIFQ F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-14193192Myocyte-specific enhancer factor 2B
1tqe_Q2e-14193192Myocyte-specific enhancer factor 2B
1tqe_R2e-14193192Myocyte-specific enhancer factor 2B
1tqe_S2e-14193192Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0987370.0AY098737.2 Lycopersicon esculentum TAGL12 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009770171.11e-149PREDICTED: agamous-like MADS-box protein AGL12
RefseqXP_016447081.11e-149PREDICTED: agamous-like MADS-box protein AGL12
SwissprotQ388417e-82AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBLA0A097BTX71e-149A0A097BTX7_TOBAC; TAGL12 transcription factor
STRINGSolyc11g032100.1.11e-135(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA98102024
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.14e-83AGAMOUS-like 12