PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016446976.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 561aa    MW: 61444.3 Da    PI: 6.0514
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016446976.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.35.6e-23198240244
             WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      epgrC+RtDGKkWRCsr+v + +k+CErH+hrgr rsrk++e
  XP_016446976.1 198 LEPGRCKRTDGKKWRCSRDVAPHQKYCERHMHRGRPRSRKHVE 240
                     69***************************************98 PP

2QLQ50.94.7e-18137171236
             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                     +FT++Q+ +L+ Q+++yKy+++  PvPp+Ll+ i+
  XP_016446976.1 137 PFTWSQWKELEKQAMIYKYMVSAIPVPPDLLLSIC 171
                     8*******************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.0E-9136172IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.022137172IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.4E-13137171IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.213197241IPR014977WRC domain
PfamPF088795.4E-19199240IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MGMEEGAING FNVSDKANLD VGKIATTICY NFQLQNTESF PSKIMMGHHQ DPHRPFSDDD  60
DNGGGGDSGP TLNHTGANKM PSSNEHNVYS DPSFLLPPPP PPLPATGGAA VVRIFQPFDI  120
STNSSPVEGM AAALGFPFTW SQWKELEKQA MIYKYMVSAI PVPPDLLLSI CTNSSGASHT  180
SSAGGSVQGQ RCRNIRDLEP GRCKRTDGKK WRCSRDVAPH QKYCERHMHR GRPRSRKHVE  240
VHAPVNNNND NKKTRNHPVT LESTPIAVPK SPPTGQTNSL STQPLRSAFQ HMEGPLFLHD  300
KMGQNIFTDP SSNELLHRSS GWTMEGELVA KAGAAQQWQH LMDSNIHPAD WQDSYREEAL  360
NLLACRDLER TEGVSMRHNG EFNFMINPEL LSLDKQSVKE APRDLINAWS NDNIYNNSNN  420
DNMEEGSLWP SEGNISPSSL TLSMAMAAGN VLDEDMGLES NVMNNTHQNK SWEKFAWVPF  480
ASGGPLAEVL HPSSSINQGE NPASSYTSNC DSISPAATTV SSPSGVLQRT MFSHSDGSVC  540
NSPILAPPTN TSETVPFQWL S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016446976.10.0PREDICTED: growth-regulating factor 3-like isoform X1
TrEMBLA0A1S3Y4A20.0A0A1S3Y4A2_TOBAC; growth-regulating factor 3-like isoform X1
STRINGXP_009791786.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.17e-35growth-regulating factor 7