PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016445819.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 361aa    MW: 41041.2 Da    PI: 9.1605
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016445819.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.76.9e-51141461128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.......kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                     lppGfrF Ptdeel+v+yL+kkv+g+++++ ++i ++d+yk++Pw Lp+       k+  +ekewyfFs+rd+ky++g+r+nr++ +gyWkatg+
  XP_016445819.1  14 LPPGFRFYPTDEELLVQYLCKKVAGHDFSM-QIIGDIDLYKFDPWVLPNfllictgKALFGEKEWYFFSPRDRKYPNGSRPNRVAGTGYWKATGT 107
                     79****************************.89***************668887654445999******************************** PP

             NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     dk ++s +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  XP_016445819.1 108 DKVITS-QGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 146
                     *****9.9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-6410169IPR003441NAC domain
PROSITE profilePS5100559.17114169IPR003441NAC domain
PfamPF023651.2E-2515146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MGVQEKDPLL QLSLPPGFRF YPTDEELLVQ YLCKKVAGHD FSMQIIGDID LYKFDPWVLP  60
NFLLICTGKA LFGEKEWYFF SPRDRKYPNG SRPNRVAGTG YWKATGTDKV ITSQGRKVGI  120
KKALVFYVGK APKGTKTNWI MHEYRLFEPS RKNGSTKLDE WVLCRIYKKN SSGQKPHMSG  180
LNSKEYSHGS STSSSSQFDD MLDSLPEMDH KFSNLPRLNS LKNFQQGEKF NLERLDSANF  240
DWAILAGLKP MPELGPANQA PGVQPQPQGH VNNHIHNHNN NNNYMNFLND GYVQPTNIRG  300
NAKVERVNLD EEVESGIRNQ GIDKSGFFQQ NINGFSQTYT NTVDQFGIQC PNQTLNLGFR  360
Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-10811754171NO APICAL MERISTEM PROTEIN
1ut4_B1e-10811754171NO APICAL MERISTEM PROTEIN
1ut7_A1e-10811754171NO APICAL MERISTEM PROTEIN
1ut7_B1e-10811754171NO APICAL MERISTEM PROTEIN
3swm_A1e-10811757174NAC domain-containing protein 19
3swm_B1e-10811757174NAC domain-containing protein 19
3swm_C1e-10811757174NAC domain-containing protein 19
3swm_D1e-10811757174NAC domain-containing protein 19
3swp_A1e-10811757174NAC domain-containing protein 19
3swp_B1e-10811757174NAC domain-containing protein 19
3swp_C1e-10811757174NAC domain-containing protein 19
3swp_D1e-10811757174NAC domain-containing protein 19
4dul_A1e-10811754171NAC domain-containing protein 19
4dul_B1e-10811754171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in abscisic acid-mediated stomatal closure (PubMed:25005917). Regulates the expression of NCED1, a gene involved in the biosynthesis of abscisic acid (ABA) (PubMed:25005917). Required for the stomatal closure induced by the bacterial pathogen Pseudomonas syringae pv tomato DC3000, but not for stomatal reopening (PubMed:25005917). {ECO:0000269|PubMed:25005917}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA), dehydration and wounding. {ECO:0000269|PubMed:25005917}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016445819.10.0PREDICTED: NAC domain-containing protein 72-like isoform X1
SwissprotQ9SQL00.0JA2_SOLLC; NAC domain-containing protein JA2
TrEMBLA0A1S3Y1110.0A0A1S3Y111_TOBAC; NAC domain-containing protein 72-like isoform X1
STRINGXP_009783061.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-124NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]