PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016445745.1
Common NameNtabSPL6-5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 522aa    MW: 56908.6 Da    PI: 9.0224
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016445745.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.73e-42163238277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cqv+gC +dls++k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk++
  XP_016445745.1 163 CQVQGCGKDLSSCKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPH 238
                     **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.5E-34156224IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.821160237IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.26E-38161240IPR004333Transcription factor, SBP-box
PfamPF031101.1E-31163236IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 522 aa     Download sequence    Send to blast
MESWSYLSGG KGFISEESVS VNDGMGRAKN GLMGWELKTP NSYVMCSSQE GSTNNQGFPE  60
LGSQNLMRKT MFSDQSIFGS VAASPSAYSG EDKSKSSSKL SSSVVESNSR DSSLIDLKLG  120
RFLDQIDANV YKSPKIMPNV SSAESIVPAK RMRAGGASSH PFCQVQGCGK DLSSCKDYHK  180
RHKVCEVHSK TAKVIVNGIE QRFCQQCSRF HLLAEFDDGK RSCRKRLAGH NERRRKPHTG  240
NRFRGTLATS SFACQDILGV RFLHQPKFEM HDWYKNVKVE DGVERSPQLV MPFSNGQLQP  300
KSVFTSYHAK KQCQPLHDEG QPAVTTSRIN ESTISSLHDI RGSDFVSPSL FHTTSTGSEV  360
LHVLDTSSTI HGLSGISNSS NALSLLSSQS RGSSNHSTVF RAAHPLISPS NNSRYSVTQA  420
SKEVLGLSPQ DSAGRLSNTF NSSGVNSAEG GLDQILFPSS TCGVNGIIQG PNFVNHKDQL  480
SCEDGPTIDL LQLSSQLQRV EHQRLSMQAK QGSNTFPGLR IT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-30156236484squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0732930.0LC073293.1 Nicotiana tabacum NtabSPL6-5 mRNA for squamosa promoter binding protein NtabSPL6-5, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001312014.10.0squamosa promoter-binding-like protein 6
RefseqXP_016445745.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A125SZN20.0A0A125SZN2_TOBAC; Squamosa promoter binding protein NtabSPL6-5
STRINGXP_009622387.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-47SBP family protein
Publications ? help Back to Top
  1. Han YY,Ma YQ,Li DZ,Yao JW,Xu ZQ
    Characterization and phylogenetic analysis of fifteen NtabSPL genes in Nicotiana tabacum L. cv. Qinyan95.
    Dev. Genes Evol., 2016. 226(1): p. 1-14
    [PMID:26635304]