PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016445515.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 392aa    MW: 42994.6 Da    PI: 8.6884
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016445515.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.92.4e-25157200144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr+rsrk++e
  XP_016445515.1 157 DPEPGRCRRTDGKKWRCSRDVVSGHKYCERHVHRGRNRSRKPVE 200
                     79***************************************987 PP

2QLQ45.91.8e-1684119136
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                     s+F+ aQ+q+L+ Q+l+y++++a++PvP eLl  ++
  XP_016445515.1  84 SYFSLAQWQELELQALIYRHMLAGAPVPLELLHLVK 119
                     79*****************************97776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.2E-884120IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.8E-1285118IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.49885120IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.911157201IPR014977WRC domain
PfamPF088793.2E-21158200IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MDFNMKQWKN QQQQQQNESE EEIQTQIPSA KLPRLVLDLD SSFSHSASDS ALPLFISEPT  60
KLSAYSLSSD STFTPTKFTR MGSSYFSLAQ WQELELQALI YRHMLAGAPV PLELLHLVKK  120
SLINSSPYNY LPQSFQQYHH YQQALVQSGY WGRTGMDPEP GRCRRTDGKK WRCSRDVVSG  180
HKYCERHVHR GRNRSRKPVE IPTTAAPSGG VNTANNDGGE VLKVNSGHAS GAPHFTLSGT  240
SPSIDVLHLN QRPSECIKEQ KGPLEAQNDV TGDGKSSGQI LRCFFDDWPR QLQEGNNARS  300
NGSSVSSATN LSISMPGNPS SDFSLKLSTG DRHNSGVGVS NVERSPWGTN QVTSMGGPLA  360
EALRSSTSNS SPTSVLHRLP RGSASEASYV ST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009783589.10.0PREDICTED: growth-regulating factor 3-like
RefseqXP_016445515.10.0PREDICTED: growth-regulating factor 3-like
TrEMBLA0A1S3Y0B50.0A0A1S3Y0B5_TOBAC; growth-regulating factor 3-like
TrEMBLA0A1U7X9I60.0A0A1U7X9I6_NICSY; growth-regulating factor 3-like
STRINGXP_009783589.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32832138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.16e-67growth-regulating factor 4