PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016445501.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 194aa    MW: 21530.2 Da    PI: 8.2927
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016445501.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.53.1e-45121111100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+C +dCv+apyfpa++p+kfanvhk+FGasnv+k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++la
  XP_016445501.1  12 PCAGCKLLRRRCGEDCVFAPYFPADEPHKFANVHKVFGASNVSKMLQELPEHKRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDMLRTQLA 106
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_016445501.1 107 MAQAE 111
                     99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.67211112IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4412109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MKEYCGKNSS SPCAGCKLLR RRCGEDCVFA PYFPADEPHK FANVHKVFGA SNVSKMLQEL  60
PEHKRGDAVS SMVYEANARV RDPVYGCVGA ISSLQQQIDM LRTQLAMAQA EVVHLRLRQS  120
AGITNSPINS GSPSSHIMGS HQPKGYFHMD LDVDQSNNGF NEPMWPXFPH NGLSPAQRIF  180
PYGFGCRPVQ QQLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-4781267125LOB family transfactor Ramosa2.1
5ly0_B5e-4781267125LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755148e-52HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016445501.11e-144PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE93e-62LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A1S3XZV71e-143A0A1S3XZV7_TOBAC; LOB domain-containing protein 4-like
STRINGXP_009783465.11e-117(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.11e-64LOB domain-containing protein 4