PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016444840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 722aa    MW: 79986.1 Da    PI: 7.198
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016444840.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-095055421954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  XP_016444840.1 505 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 542
                     664459******************************88 PP

2BELL118.14.2e-38366436272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     r  +q++k kLls+ +eVdkrY++y+eq+q+v++sF+ v+g g+a+pYt+lA+ka+SrhF+cLkdaia q+
  XP_016444840.1 366 RIGHQRRKIKLLSMFDEVDKRYNHYCEQMQMVVNSFDLVMGFGAAAPYTALAQKAMSRHFKCLKDAIAAQL 436
                     6679****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-72289434IPR006563POX domain
PfamPF075268.9E-52294433IPR006563POX domain
PROSITE profilePS5007112.487483546IPR001356Homeobox domain
SMARTSM003894.0E-9486550IPR001356Homeobox domain
CDDcd000866.11E-12486547No hitNo description
SuperFamilySSF466896.42E-17488552IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.9E-28489552IPR009057Homeodomain-like
PfamPF059203.6E-18503542IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    Send to blast
MVIHFNKSKA VHNPIQLPKK SISLDNSMSQ DYHHQGLFSF SSVFEKPQNE QQQHIAHQIR  60
QEKLRVEGFN PPPPLVAIEE EQSSGLQVYG TAGMLSEMFN FPPGTTTATA TELLQNQLTQ  120
CYRHPNQRPQ QQLPWTTNLG SEWFSNRQGM VVGGSLQRQH NQISSINAAE SAMNLFAMNP  180
QPRSPSPSSS HPTTTTLQGF PNAGGGHFGQ FICGGASNTG NNFTNEIGGV NVIEGQGLSL  240
SLSSSLQHLE AAKVEDQLRM SGEEMLFFNQ GTSENHHHHQ VHVGFGSSLG LVNVLRNSKY  300
AKAAQELLEE FCSVGRSQLF KKNKVSRNNN TTTSSNPNSN NPSRSNNHNT NSSSSKDLPP  360
LSAADRIGHQ RRKIKLLSMF DEVDKRYNHY CEQMQMVVNS FDLVMGFGAA APYTALAQKA  420
MSRHFKCLKD AIAAQLKHSC ELLGEKDTTT SGLTKGETPR LKLLEKSLRQ QQTAFHQMGM  480
MDAEAWRPQR GLPERSVTIL RAWLFEHFLH PYPSDADKHL LARQTGLSRN QVSNWFINAR  540
VRLWKPMVED MYQKEAKEEE DDEMEKSQNS SNNIAQTPTP NSSTNTITTG TGTETKTAAT  600
VAATILTVAS DKRSEINVLE NDPSIVAMNR LCFSENQAQH HESSSMATHE MAHNNFPAIQ  660
DSDDMSRREA VSGVEYGTTN IMANSDNGTR VIRFGTSVAG DVSLTLGLHH AGNLPENSHF  720
FG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B2e-15492549562Homeobox protein Meis2
3k2a_A2e-15492549562Homeobox protein Meis2
4xrm_B2e-15492549562Homeobox protein Meis2
4xrm_A2e-15492549562Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016444840.10.0PREDICTED: BEL1-like homeodomain protein 4 isoform X2
TrEMBLQ8LLE00.0Q8LLE0_SOLTU; BEL1-related homeotic protein 22 (Fragment)
STRINGPGSC0003DMT4000261720.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-133BEL1-like homeodomain 2