PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016444838.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 745aa    MW: 82655 Da    PI: 7.0532
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016444838.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.5e-095285651954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  XP_016444838.1 528 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 565
                     664459******************************88 PP

2BELL1184.3e-38389459272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     r  +q++k kLls+ +eVdkrY++y+eq+q+v++sF+ v+g g+a+pYt+lA+ka+SrhF+cLkdaia q+
  XP_016444838.1 389 RIGHQRRKIKLLSMFDEVDKRYNHYCEQMQMVVNSFDLVMGFGAAAPYTALAQKAMSRHFKCLKDAIAAQL 459
                     6679****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-72312457IPR006563POX domain
PfamPF075269.4E-52317456IPR006563POX domain
PROSITE profilePS5007112.487506569IPR001356Homeobox domain
CDDcd000866.54E-12509570No hitNo description
SMARTSM003894.0E-9509573IPR001356Homeobox domain
SuperFamilySSF466896.84E-17511575IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.2E-28512575IPR009057Homeodomain-like
PfamPF059203.8E-18526565IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 745 aa     Download sequence    Send to blast
MVIHFNKSKA VHNPIQLPKK SISLDNSMSQ DYHHQGLFSF SSVFEKPQNE QQQHIAHQIR  60
QEKLRVEGFN PPPPLVAIEE EQSSGLQVYG TAGMLSEMFN FPPGTTTATA TELLQNQLTQ  120
CYRHPNQRPQ QQLPWTTNLG SEWFSNRQGM VVGGSLQVLS ESIDNLKELN DRNNITAHYQ  180
RQHNQISSIN AAESAMNLFA MNPQPRSPSP SSSHPTTTTL QGFPNAGGGH FGQFICGGAS  240
NTGNNFTNEI GGVNVIEGQG LSLSLSSSLQ HLEAAKVEDQ LRMSGEEMLF FNQGTSENHH  300
HHQVHVGFGS SLGLVNVLRN SKYAKAAQEL LEEFCSVGRS QLFKKNKVSR NNNTTTSSNP  360
NSNNPSRSNN HNTNSSSSKD LPPLSAADRI GHQRRKIKLL SMFDEVDKRY NHYCEQMQMV  420
VNSFDLVMGF GAAAPYTALA QKAMSRHFKC LKDAIAAQLK HSCELLGEKD TTTSGLTKGE  480
TPRLKLLEKS LRQQQTAFHQ MGMMDAEAWR PQRGLPERSV TILRAWLFEH FLHPYPSDAD  540
KHLLARQTGL SRNQVSNWFI NARVRLWKPM VEDMYQKEAK EEEDDEMEKS QNSSNNIAQT  600
PTPNSSTNTI TTGTGTETKT AATVAATILT VASDKRSEIN VLENDPSIVA MNRLCFSENQ  660
AQHHESSSMA THEMAHNNFP AIQDSDDMSR REAVSGVEYG TTNIMANSDN GTRVIRFGTS  720
VAGDVSLTLG LHHAGNLPEN SHFFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B2e-15515572562Homeobox protein Meis2
3k2a_A2e-15515572562Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016444838.10.0PREDICTED: BEL1-like homeodomain protein 4 isoform X1
RefseqXP_016444839.10.0PREDICTED: BEL1-like homeodomain protein 4 isoform X1
SwissprotQ9SW801e-149BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLQ8LLE00.0Q8LLE0_SOLTU; BEL1-related homeotic protein 22 (Fragment)
STRINGPGSC0003DMT4000261720.0(Solanum tuberosum)
STRINGVIT_04s0023g01020.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33412139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-133BEL1-like homeodomain 2