PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016444742.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 190aa    MW: 20818.8 Da    PI: 7.711
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016444742.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.12.6e-42351341100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++Cvlapyfp ++p kf  +h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+la
  XP_016444742.1  35 PCAACKILRRRCAEKCVLAPYFPPNDPIKFTTAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARLRDPVYGSAGAICQLQKQVNELQAQLA 129
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_016444742.1 130 KAQAE 134
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.01134135IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-4235132IPR004883Lateral organ boundaries, LOB
Gene3DG3DSA:1.20.58.608.2E-487154No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MESSRTVTTT KTPLSPCFVS PSRSSPSPPR VVVTPCAACK ILRRRCAEKC VLAPYFPPND  60
PIKFTTAHRV FGASNIIKFL QELPESQRAD AVSSMVYEAN ARLRDPVYGS AGAICQLQKQ  120
VNELQAQLAK AQAEIVNMQC QQANLMALLY LEMDQSPPAS SELVHNAFQS GMSFLDDQNN  180
NFGISLSGYD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-423514211118LOB family transfactor Ramosa2.1
5ly0_B9e-423514211118LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754455e-53HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016444742.11e-139PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR01e-71LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A1S3XYE71e-138A0A1S3XYE7_TOBAC; LOB domain-containing protein 1-like
STRINGXP_009772858.11e-138(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.16e-64LOB domain-containing protein 1