PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016444499.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 622aa    MW: 69857.7 Da    PI: 5.3111
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016444499.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-094114481954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +e+  LA+++gLt +qV +WF N R +
  XP_016444499.1 411 FEHflHPYPKDSEKIMLARQTGLTRSQVANWFINARVR 448
                     554459******************************88 PP

2BELL1231.3e-39277348172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     er++l++k +kL s+l+eVd+rYk y++q+q+v+ssFe+vaglg+akpYtslAlk+iSr+FrcL+dai++qi
  XP_016444499.1 277 ERHDLESKMTKLFSMLDEVDRRYKEYYQQMQAVVSSFEMVAGLGAAKPYTSLALKTISRQFRCLRDAIKKQI 348
                     799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.8E-53201346IPR006563POX domain
PfamPF075262.8E-45207344IPR006563POX domain
PROSITE profilePS5007112.341389452IPR001356Homeobox domain
SMARTSM003894.4E-10392456IPR001356Homeobox domain
CDDcd000862.49E-12392453No hitNo description
SuperFamilySSF466892.69E-17393458IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-28395458IPR009057Homeodomain-like
PfamPF059202.0E-17409448IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MSAYYSNLSN QREVLPMSFL PDQKFDSYHS AGLSDSSIHL NQHSSTVSYS ELPAQSYGEV  60
QTIRGKDEML FIPPTSESGS MQPIGRSVNA APNFLDNSVM MDPRSFPTKQ LFVPNIEQSL  120
QNQGLSLSLG TQVPPSLHVY SYQDDYTNSS LSSLVGTHVL HSEQGSEDKE SKVAEYLSFD  180
LARGTRAANN PQNSMSLRNM NSGAHSIYNS KNLKAAQDLL DEVVNVQEAL KQSDRLRNFN  240
LLGQDRSEEA DLKSSCSASG ISGDQNNSIK GELSPAERHD LESKMTKLFS MLDEVDRRYK  300
EYYQQMQAVV SSFEMVAGLG AAKPYTSLAL KTISRQFRCL RDAIKKQIQV TRRSLGEQGD  360
SQGERLYRLR YVDQQLRQQR SLQQFGMMRQ PWRPQRGLPE TAVSVLRAWL FEHFLHPYPK  420
DSEKIMLARQ TGLTRSQVAN WFINARVRLW KPMIEDMYKE EFGEAEAGSG ASPDRAPEES  480
KEKSIAENTG EEIPESFTTP AVNCSHLDPS DESSNVVTNV QNNSFITKFS FQDGAYEHEK  540
IDAVNTYHAS MLGDIMGNQV SLALRLQNSQ IDQQPISGRT QLAEDDKTGS TLDISKGEYY  600
YIDPVNQQER FSGPHLLSDF VA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B1e-16398455158Homeobox protein Meis1
4xrs_A1e-16398455158Homeobox protein Meis1
3k2a_B1e-16398455562Homeobox protein Meis2
3k2a_A1e-16398455562Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016444498.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_016444499.10.0PREDICTED: BEL1-like homeodomain protein 7
SwissprotQ9FXG81e-111BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLM0ZWL90.0M0ZWL9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000096100.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.22e-98BEL1-like homeodomain 6