PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016444360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 469aa    MW: 51254.5 Da    PI: 7.0012
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016444360.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC73.32.7e-23164207144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+ep+rC+RtDGKkWRC r+v +++k+CErH h+++ rsrk++e
  XP_016444360.1 164 DPEPWRCKRTDGKKWRCTRDVAPDQKYCERHAHKSKPRSRKPVE 207
                     79***************************************987 PP

2QLQ36.91.1e-13105140237
             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     +FTa+Qlq++ +Q  + Ky++a++PvPp+Ll+++++
  XP_016444360.1 105 PFTASQLQEFQRQTIICKYIMASVPVPPQLLLPLSN 140
                     9********************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.3E-5104140IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166617.823105140IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.4E-10105138IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.489164208IPR014977WRC domain
PfamPF088791.1E-18165207IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MGNGENTELL DLKMKTTESS PSSYPYKRTM FMSPSSHPHL AAFDKETSSN STCLADDGGS  60
GGGGGGGPGD FVGSDSYAAA ALSSRALQPF SCSARESMFL SGKAPFTASQ LQEFQRQTII  120
CKYIMASVPV PPQLLLPLSN NPSSAHLPQS NTSGLDLKFS RGSDPEPWRC KRTDGKKWRC  180
TRDVAPDQKY CERHAHKSKP RSRKPVEIHN TNNNSNNRHP PPPTTRNHHR SLQFPTVQLS  240
EQTRCIEWLG RGDRGGTIPI ISCNQQNLQQ LMQSSSGMGF NNDHTDLNRR NTPAFQMQDE  300
AKLYPMNNFN QYISNRSSGQ TLESSPLKNE ECSDSVIASL QGRTTRDFID AWSKDGLNDG  360
ISNNGSFTSL TLSMSGWNHG MDEDNEHAQV SINRMLDSER SSDEVLRSQW LSPVSWMSST  420
APGGPLGEAL CLGNATNLPS PHGYSNSTAN SSCSFNSCEN GSHGLDFIG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016444360.10.0PREDICTED: growth-regulating factor 8-like
TrEMBLA0A1S3XWV80.0A0A1S3XWV8_TOBAC; growth-regulating factor 8-like
STRINGXP_009784757.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA125171820
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.11e-23growth-regulating factor 2