PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016443568.1
Common NameNtabSPL13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 310aa    MW: 33954.6 Da    PI: 8.2826
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016443568.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.61.1e-402298278
                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP  2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
                    C v+gC+adls+++eyhrrhkvCevhsk+++v++ g+ qrfCqqCsrfh+l efD++krsCr+rL++hn+rrrk+q+
  XP_016443568.1 22 CLVDGCNADLSQCREYHRRHKVCEVHSKTAKVTIGGRDQRFCQQCSRFHSLVEFDDGKRSCRKRLDGHNRRRRKPQP 98
                    **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.5E-321783IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.6841996IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.27E-3820101IPR004333Transcription factor, SBP-box
PfamPF031103.5E-302295IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MESSSSSKRA KAPGNIAQVA HCLVDGCNAD LSQCREYHRR HKVCEVHSKT AKVTIGGRDQ  60
RFCQQCSRFH SLVEFDDGKR SCRKRLDGHN RRRRKPQPDS MAKTSGLLFT GQQVVSSAWA  120
GVVKTDSDMV LYNNINCMDN QNSFPDSSAR SSYKGGNQFQ FMQGSERSLP EASICQPLVD  180
HPNSTAAVPS SGQKIFSSGL NEIVDSDRAL SLLSSAPAVT REIGFSHMVQ QPASIPRPRP  240
QSQSVVHSLH YGGLSQYPFA QDFNSQPQDS AADSHVSNSS SLHFHDMLQN APDGSSTSGG  300
CQQTLAFMWD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-2922951184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17895KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0733000.0LC073300.1 Nicotiana tabacum NtabSPL13 mRNA for squamosa promoter binding protein NtabSPL13, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016443568.10.0PREDICTED: teosinte glume architecture 1-like isoform X2
TrEMBLA0A1S3XUE60.0A0A1S3XUE6_TOBAC; teosinte glume architecture 1-like isoform X2
STRINGXP_009621034.10.0(Nicotiana tomentosiformis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-44SBP family protein
Publications ? help Back to Top
  1. Han YY,Ma YQ,Li DZ,Yao JW,Xu ZQ
    Characterization and phylogenetic analysis of fifteen NtabSPL genes in Nicotiana tabacum L. cv. Qinyan95.
    Dev. Genes Evol., 2016. 226(1): p. 1-14
    [PMID:26635304]