PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016443041.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 268aa    MW: 29177.9 Da    PI: 9.7922
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016443041.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601223.1e-38561551100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rr+Ca+ C+lapyfpae++k+f n+hklFG+sn+lk+lk++p+ ++++am++l++eA++ra+dPv G+++vi++l++q++  +a+l+
  XP_016443041.1  56 ACAACKYQRRRCASVCPLAPYFPAERQKDFLNAHKLFGVSNILKVLKNVPPFQKDNAMKALIFEANIRADDPVGGSHRVIQNLHRQINLYQAQLQ 150
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     l+ ++
  XP_016443041.1 151 LVYHQ 155
                     99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.41555156IPR004883Lateral organ boundaries, LOB
PfamPF031958.3E-3756152IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MTNVVNNTQN ISPLATPASA TTYAVTTSTR SNPSNITRVA SRGGGGGGSG ANGSQACAAC  60
KYQRRRCASV CPLAPYFPAE RQKDFLNAHK LFGVSNILKV LKNVPPFQKD NAMKALIFEA  120
NIRADDPVGG SHRVIQNLHR QINLYQAQLQ LVYHQIVRVQ EAAIQEQQNF NTMASVRGTN  180
STLNFDMLPL HDLHGFDRSN SISLGEAGSS SQIVKGKGVE RFSSAEEFEA KTMMTHSDGK  240
QPLVESEHIK PYFGSIHNFK GKGVTTEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-26481587113LOB family transfactor Ramosa2.1
5ly0_B9e-26481587113LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016443041.10.0PREDICTED: LOB domain-containing protein 7-like, partial
TrEMBLA0A1S3XSW60.0A0A1S3XSW6_TOBAC; LOB domain-containing protein 7-like
STRINGXP_009607074.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA142941012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.17e-33LOB domain-containing protein 22