PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016442877.1
Common NameKNAT1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 352aa    MW: 40165.8 Da    PI: 6.1192
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016442877.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-092793132155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++e+  LA+ +gL+++q+ +WF N+R ++
  XP_016442877.1 279 KWPYPSESEKVALAETTGLDQKQINNWFINQRKRH 313
                     669*****************************885 PP

2ELK383.6e-13233254122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++LlrKYsgyL+sLkqE+s
  XP_016442877.1 233 ELKNHLLRKYSGYLSSLKQELS 254
                     9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.0E-2099143IPR005540KNOX1
PfamPF037901.7E-22100142IPR005540KNOX1
SMARTSM012561.2E-23150201IPR005541KNOX2
PfamPF037913.7E-23154199IPR005541KNOX2
PROSITE profilePS5121311.296233253IPR005539ELK domain
PfamPF037892.4E-10233254IPR005539ELK domain
SMARTSM011883.5E-7233254IPR005539ELK domain
PROSITE profilePS5007112.924253316IPR001356Homeobox domain
SuperFamilySSF466891.63E-19254328IPR009057Homeodomain-like
SMARTSM003895.4E-13255320IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.6E-27258319IPR009057Homeodomain-like
CDDcd000866.04E-12265317No hitNo description
PfamPF059208.2E-17273312IPR008422Homeobox KN domain
PROSITE patternPS000270291314IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MENNYNQLGE NSAQRGNNFL YGGIPLLASP NSSIYGRSSG GGGDCYDQSQ AVVHPIVKTE  60
GGSTSHHHTF QYPSIIRSGY HHLTVQNHHE SESSGSEVDA LKAKIIAHPQ CSNLLDAYMD  120
CQKVGAPPEV VARLSAVRQE FEVRQRDSST DRNIAKDPEL DQFMEAYYDM LVKYREELTR  180
PLHEAMDFMR KIETQLNMLE DNCEGVGSSE EEQDNSGGET EIPEIDPRAE DRELKNHLLR  240
KYSGYLSSLK QELSKKKKKG KLPKDARQKL LSWWELHYKW PYPSESEKVA LAETTGLDQK  300
QINNWFINQR KRHWKPSEDM QFMVMDGLHP QNAAALYMEG HYMGEGPFRL GQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0257140.0AB025714.1 Nicotiana tabacum mRNA for homeobox 20, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009760091.10.0PREDICTED: homeotic protein knotted-1 isoform X2
RefseqXP_016442877.10.0PREDICTED: homeotic protein knotted-1-like isoform X2
SwissprotQ413300.0KN1_SOLLC; Homeotic protein knotted-1
TrEMBLV9LXK80.0V9LXK8_TOBAC; Knotted 1
STRINGPGSC0003DMT4000127120.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-132KNOTTED-like from Arabidopsis thaliana