PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016442774.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 186aa    MW: 21801.2 Da    PI: 10.5033
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016442774.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.48.2e-28959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien++ rqvtfskRr+g+lKKA+ELS+LCdaeva++ifs++gk y ++s
  XP_016442774.1  9 KRIENQTSRQVTFSKRRTGLLKKAFELSILCDAEVALLIFSPSGKAYQFAS 59
                    79**********************************************986 PP

2K-box66.31.1e-22891701798
           K-box  17 lqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      + e++ + + i++L+   +h+ GedL++L +keL+qLe+qL  ++++iRskK +++ eqi+ l+++ k l+een  L+k++
  XP_016442774.1  89 RRSEIEDMTRTIDELEARDKHFAGEDLSTLGMKELKQLERQLRIGVERIRSKKRRIISEQINWLKRRHKILHEENIHLQKQV 170
                     56899************9*************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.66161IPR002100Transcription factor, MADS-box
CDDcd002651.56E-39278No hitNo description
SuperFamilySSF554552.49E-31278IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-30323IPR002100Transcription factor, MADS-box
PfamPF003192.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-303859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.89186178IPR002487Transcription factor, K-box
PfamPF014864.9E-2289170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MGRGKVELKR IENQTSRQVT FSKRRTGLLK KAFELSILCD AEVALLIFSP SGKAYQFASP  60
DIDRTILRYK NEVGLSKTID QGFRAMEVRR SEIEDMTRTI DELEARDKHF AGEDLSTLGM  120
KELKQLERQL RIGVERIRSK KRRIISEQIN WLKRRHKILH EENIHLQKQV RLHELREGEG  180
SSIFLD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-24169169Myocyte-specific enhancer factor 2B
1tqe_Q3e-24169169Myocyte-specific enhancer factor 2B
1tqe_R3e-24169169Myocyte-specific enhancer factor 2B
1tqe_S3e-24169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2706241e-164KF270624.1 Solanum lycopersicum cultivar Florida Petite TM8-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016442774.11e-132PREDICTED: MADS-box protein SOC1-like
RefseqXP_016442773.11e-132PREDICTED: MADS-box protein SOC1-like
TrEMBLA0A0B4N0Q91e-108A0A0B4N0Q9_SOLLC; TM8-like protein
STRINGPGSC0003DMT4000393131e-106(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.13e-44AGAMOUS-like 20