PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016442736.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 700aa    MW: 76613.2 Da    PI: 7.012
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016442736.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.1e-093874241954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp  +++  LAk++gLt +qV++WF N R +
  XP_016442736.1 387 FEHflHPYPRDSDKMMLAKQTGLTRSQVSNWFINARVR 424
                     554459******************************88 PP

2BELL113.21.4e-36251322172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqe+q+kkakL+++l+eV++rY++y++q+q vis  e++ag+gsak Yt+lAlk+iS++FrcLkdai++qi
  XP_016442736.1 251 ERQEIQMKKAKLVNMLDEVEQRYRHYHQQMQSVISWLEQAAGIGSAKTYTALALKTISKQFRCLKDAITGQI 322
                     79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.8E-58173320IPR006563POX domain
PfamPF075266.7E-47182319IPR006563POX domain
PROSITE profilePS5007112.115365428IPR001356Homeobox domain
CDDcd000864.85E-12368429No hitNo description
SMARTSM003891.3E-9368432IPR001356Homeobox domain
SuperFamilySSF466898.98E-17369434IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-28371434IPR009057Homeodomain-like
PfamPF059207.3E-18385424IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
MAAYFDGNSE IQGGNDGLQT LILMNPAGYV GFSETQQPPA GGSNLVFFNS NPLGNSLNLP  60
HARPSSQQQQ FVGIPLATSV FTAPSSFPDG TTTPTVHSQH DISALHGFLA RSHEYGFYNP  120
SNDITEARDV TRAQQQGLSL SLSSQQPGFG NFRPEREELV TTVSPTAGGG SSSSVQSVPL  180
SPKYLKAAQE LLDEVVNVGK AVKTSTTTED VNYSQKSKNN GESSGNMATA AGQEGGETNS  240
KRDGPELSAA ERQEIQMKKA KLVNMLDEVE QRYRHYHQQM QSVISWLEQA AGIGSAKTYT  300
ALALKTISKQ FRCLKDAITG QIRSASKTLG EDDSFGGKIE GSRLKFVDNQ IRQQRALQQL  360
GMIQHNAWRP QRGLPERAVS VLRAWLFEHF LHPYPRDSDK MMLAKQTGLT RSQVSNWFIN  420
ARVRLWKPMV EEMYLEEIKE QEQNGSDLEK TSKLGEQNED STSRSIGPQE KSPRSDSQNK  480
SFLSKHDNNL ANHNPASTIP KSNTSSISPT GLSIRNNTGF NLIGSPEKES INVAQGSQKK  540
PRSNEMLHSP NSVPSINMDV KPNEEQMLIK FGDDRQNRDG FSLMGGPTNF MGGFGSYPIG  600
EIGRFSTEQF SAPYSTSGTV SLTLGLPHSE NLSMSATHHS FLPIPTQSIQ MGRGVVEIGE  660
ANEFGSLNTP TSAHSTSVYE NFNIQNRKRF AAPLLPDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16374432563Homeobox protein Meis2
3k2a_B2e-16374432563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6863850.0EU686385.1 Solanum etuberosum BEL29 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016442736.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016442743.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-158BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLM1BX380.0M1BX38_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000549450.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-150BEL1-like homeodomain 1