PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016442590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 125aa    MW: 14300.5 Da    PI: 7.2102
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016442590.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.31.4e-34121111100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaC +lr++C ++C lapyfp++++++f+nv +lFG+sn++++l+++++e++ ++++sl+ eA++r ++PvyG++++ +k++  +e++++el+
  XP_016442590.1  12 KCAACTHLRKRCDANCQLAPYFPSNRTEDFQNVYQLFGVSNIINMLNSVDDEQKGKMAESLILEAKIRKENPVYGCLAIERKMKLAIEEAEKELE 106
                     5********************************************************************************************** PP

          DUF260  96 llkee 100
                      ++++
  XP_016442590.1 107 IVHKQ 111
                     99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.67811112IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-3312109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MENANPLIST EKCAACTHLR KRCDANCQLA PYFPSNRTED FQNVYQLFGV SNIINMLNSV  60
DDEQKGKMAE SLILEAKIRK ENPVYGCLAI ERKMKLAIEE AEKELEIVHK QNAFCKEMAK  120
SQMQK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-221311112110LOB family transfactor Ramosa2.1
5ly0_B4e-221311112110LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009784719.12e-88PREDICTED: LOB domain-containing protein 27-like
RefseqXP_016442590.12e-88PREDICTED: LOB domain-containing protein 27-like
TrEMBLA0A1S3XRT84e-87A0A1S3XRT8_TOBAC; LOB domain-containing protein 27-like
TrEMBLA0A1U7XCP94e-87A0A1U7XCP9_NICSY; LOB domain-containing protein 27-like
STRINGXP_009784719.17e-88(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28661752
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.13e-24LOB domain-containing protein 27