PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016442369.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 259aa    MW: 29840.9 Da    PI: 10.0179
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016442369.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.58.7e-29959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+ rqvtfskRr g+lKKA+E+SvLCda+va+i+fs++gkl+eyss
  XP_016442369.1  9 KRIENKISRQVTFSKRRSGLLKKANEISVLCDADVALIVFSTKGKLFEYSS 59
                    79***********************************************96 PP

2K-box98.69.4e-3379173599
           K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                     + ++++   +e+++ e+ kL ++ie +qr++Rh+ G+dL++Lsl+eLq+Leqq++++lk+iRs+Kn+l++e+i+elqkkek+lqe+n++++kkl+
  XP_016442369.1  79 KLNANDVDPMENWTLEHPKLMSRIELIQRNIRHYTGQDLDPLSLRELQSLEQQMDTALKRIRSRKNQLMHESISELQKKEKALQEQNNSMTKKLK 173
                     55556667789*********************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.651161IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.42E-34292IPR002100Transcription factor, MADS-box
CDDcd002659.79E-33276No hitNo description
PRINTSPR004045.8E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.9E-2786172IPR002487Transcription factor, K-box
PROSITE profilePS5129716.54588178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MGRGRVQLKR IENKISRQVT FSKRRSGLLK KANEISVLCD ADVALIVFST KGKLFEYSSE  60
SSMESILERY ERYSYAERKL NANDVDPMEN WTLEHPKLMS RIELIQRNIR HYTGQDLDPL  120
SLRELQSLEQ QMDTALKRIR SRKNQLMHES ISELQKKEKA LQEQNNSMTK KLKDEEKVQS  180
GKIQPNSGQN SATFMLPQQP PPQSHQLPNL TIGYSLSLTH TQSGPFEATR IKNTDGDRAH  240
YGSNSLMPPW MIRHVNNDG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-20174173Myocyte-specific enhancer factor 2B
1tqe_Q5e-20174173Myocyte-specific enhancer factor 2B
1tqe_R5e-20174173Myocyte-specific enhancer factor 2B
1tqe_S5e-20174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3352450.0AF335245.1 Petunia x hybrida MADS-box transcription factor FBP29 (FBP29) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016442369.10.0PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X1
SwissprotQ424293e-98AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLQ9ATE21e-146Q9ATE2_PETHY; MADS-box transcription factor FBP29
STRINGSolyc02g089210.2.11e-124(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4992397
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.15e-83AGAMOUS-like 8