PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016442060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family S1Fa-like
Protein Properties Length: 85aa    MW: 9480.32 Da    PI: 10.2543
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016442060.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA129.87.3e-411885370
            S1FA  3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                    ++ ve++G+nPGl+vl+vvgglll flvgny+ly+yaqk+lPP+kkkPvskkklkre+lkqGv++PGe
  XP_016442060.1 18 TKDVEVQGFNPGLMVLIVVGGLLLAFLVGNYLLYMYAQKTLPPKKKKPVSKKKLKRERLKQGVSAPGE 85
                    5679***************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0190130.0081885No hitNo description
PfamPF046892.5E-392185IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MDYEGDPPPS FDPMKNMTKD VEVQGFNPGL MVLIVVGGLL LAFLVGNYLL YMYAQKTLPP  60
KKKKPVSKKK LKRERLKQGV SAPGE
Functional Description ? help Back to Top
Source Description
UniProtDNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009601142.12e-54PREDICTED: DNA-binding protein S1FA-like
RefseqXP_016442060.12e-54PREDICTED: DNA-binding protein S1FA-like
SwissprotP425532e-14S1FA1_ORYSJ; DNA-binding protein S1FA1
TrEMBLA0A1S3XQC24e-53A0A1S3XQC2_TOBAC; DNA-binding protein S1FA-like
STRINGXP_009601142.17e-54(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31742249