PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016442044.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 382aa    MW: 43500 Da    PI: 6.5084
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016442044.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26069.57.4e-22697192
          DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92
                    +Ca+Ck +r kC+++C +   +p e+ k+++ +h++FG s+   +++++++ +r+++++s +y+A+ r++ P+ G+ + i +l+ ql+++k 
  XP_016442044.1  6 SCAVCKQQRVKCKPNCKFLNNLPREKYKTYEKIHQVFGFSQFEIFYDKVDQRNRDRMIDSYLYQANSRIERPILGVNQEIESLKFQLANTKR 97
                    6**************************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089115.7565105IPR004883Lateral organ boundaries, LOB
PfamPF031956.3E-19697IPR004883Lateral organ boundaries, LOB
PfamPF008992.9E-792235IPR000594THIF-type NAD/FAD binding fold
Gene3DG3DSA:3.40.50.7205.1E-3193373IPR016040NAD(P)-binding domain
SuperFamilySSF695721.83E-3096370IPR000594THIF-type NAD/FAD binding fold
PRINTSPR018498.0E-6104128IPR000011Ubiquitin/SUMO-activating enzyme E1
PRINTSPR018498.0E-6223250IPR000011Ubiquitin/SUMO-activating enzyme E1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006464Biological Processcellular protein modification process
GO:0008641Molecular Functionsmall protein activating enzyme activity
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MDRRHSCAVC KQQRVKCKPN CKFLNNLPRE KYKTYEKIHQ VFGFSQFEIF YDKVDQRNRD  60
RMIDSYLYQA NSRIERPILG VNQEIESLKF QLANTKRLAA EEILVSGLGV TLVEFCKYIM  120
VAGVKSVTLH DDRMATPELL RINTLINPDD YRDKTISQLC KDTLMKFNST VALHVLQGSL  180
SNLNDAEFQE FDAVIISSCS EKRRSELNLR LRQLPKPVAF YSVECRGCLA EIFVDLNNQI  240
KSERLFGETV DTILEFPSFE RAIAVPWQEL PQGMSKVYYA MRVAENFEAT NGRFPGELYD  300
GDIENIKTFK DLFCATQHFT PDSIPDAIIA KLVGGTTCDI FSIVGAIMAQ DFIHYKSGGK  360
PIKNFFLYDG GAAEGMVTEI GC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009605566.10.0PREDICTED: SUMO-activating enzyme subunit 1B-1-like
RefseqXP_016442044.10.0PREDICTED: SUMO-activating enzyme subunit 1B-1-like
TrEMBLA0A1S3XQ900.0A0A1S3XQ90_TOBAC; SUMO-activating enzyme subunit 1B-1-like
STRINGXP_009605566.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA402633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72980.11e-11LOB domain-containing protein 7