PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016441622.1
Common NameKNAT1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 366aa    MW: 41624.3 Da    PI: 6.3068
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016441622.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-092933272155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++e+  LA+ +gL+++q+ +WF N+R ++
  XP_016441622.1 293 KWPYPSESEKVALAETTGLDQKQINNWFINQRKRH 327
                     669*****************************885 PP

2ELK37.93.8e-13247268122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++LlrKYsgyL+sLkqE+s
  XP_016441622.1 247 ELKNHLLRKYSGYLSSLKQELS 268
                     9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.0E-20103147IPR005540KNOX1
PfamPF037901.8E-22104146IPR005540KNOX1
SMARTSM012562.5E-25154205IPR005541KNOX2
PfamPF037911.6E-23158203IPR005541KNOX2
SMARTSM011883.5E-7247268IPR005539ELK domain
PfamPF037892.6E-10247268IPR005539ELK domain
PROSITE profilePS5121311.296247267IPR005539ELK domain
PROSITE profilePS5007112.924267330IPR001356Homeobox domain
SuperFamilySSF466891.71E-19268342IPR009057Homeodomain-like
SMARTSM003895.4E-13269334IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.8E-27272333IPR009057Homeodomain-like
CDDcd000861.07E-11279331No hitNo description
PfamPF059208.6E-17287326IPR008422Homeobox KN domain
PROSITE patternPS000270305328IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MENNYNQLGE NSSQRGNNFL YGGIPLLSSP NSSIYGRTSG GGGGGDCYDQ SQAVVHPIVK  60
TEGGSSTSHH HHTFQYPSII RSGYHHQTVQ NHHESESSGS EVDALKAKII AHPQCSNLLD  120
AYMDCQKVGA PPEVVARLSA VRQEFEVRQR DSSTDRDVSK DPELDQFMEA YYDMLVKYRE  180
ELTRPLHEAM DFMRKIETQL NMLGNGPVRI FNSEDKCEGV GSSEEEQDNS GGETEIPEID  240
PRAEDRELKN HLLRKYSGYL SSLKQELSKK KKKGKLPKDA RQKLLSWWEL HYKWPYPSES  300
EKVALAETTG LDQKQINNWF INQRKRHWKP SEDMQFMVMD GLHPQNAAAL YMEGHYMGEG  360
PFRLGQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6869310.0JQ686931.1 Nicotiana tabacum cultivar SR1 Knotted 1 (KNAT1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598343.10.0PREDICTED: homeotic protein knotted-1 isoform X1
RefseqXP_016441622.10.0PREDICTED: homeotic protein knotted-1-like isoform X1
SwissprotQ413300.0KN1_SOLLC; Homeotic protein knotted-1
TrEMBLV9LXK80.0V9LXK8_TOBAC; Knotted 1
STRINGPGSC0003DMT4000127120.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49732333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-137KNOTTED-like from Arabidopsis thaliana