PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016441586.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 119aa    MW: 13657.6 Da    PI: 8.7464
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016441586.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP68.81.1e-2165113149
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 
                     +C++e+C +dls ak+y++rhkvC+vh+kap vlv+gl+qrf qqC r 
  XP_016441586.1  65 RCKMEKCGVDLSGAKKYYKRHKVCQVHAKAPIVLVAGLRQRFFQQCNRL 113
                     6*********************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-2158113IPR004333Transcription factor, SBP-box
PROSITE profilePS5114117.34963119IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.79E-2064113IPR004333Transcription factor, SBP-box
PfamPF031105.0E-1666113IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MATHIYGMPL KNTAENNDFD EEEETEEEEE ENVGVELIEE SNLKRKRLNL EKRKGSNSKG  60
GGGPRCKMEK CGVDLSGAKK YYKRHKVCQV HAKAPIVLVA GLRQRFFQQC NRLFPSRRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-1458113258squamosa promoter binding protein-like 4
1wj0_A7e-1561113153squamosa promoter-binding protein-like 12
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016441586.11e-83PREDICTED: squamosa promoter-binding protein 2-like
SwissprotQ387402e-19SBP2_ANTMA; Squamosa promoter-binding protein 2
TrEMBLA0A1S3XNS53e-82A0A1S3XNS5_TOBAC; squamosa promoter-binding protein 2-like
STRINGXP_009601043.14e-83(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2403522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.13e-18squamosa promoter binding protein-like 9
Publications ? help Back to Top
  1. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]