PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016441570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 238aa    MW: 27484.3 Da    PI: 9.7897
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016441570.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.38.2e-281059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    ri+n++ rqvtfskRrng+lKKA+EL +LCdaev viifsst klyeyss
  XP_016441570.1 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVIIFSSTSKLYEYSS 59
                    8***********************************************96 PP

2K-box86.36.1e-29841711299
           K-box  12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                     ++ + +q+e+a L++++enLq+++R+++Ge+L+ L++k+Lq+Le+qLe sl+ +R +K+++++++++el +k +  ++en++L kkl+
  XP_016441570.1  84 SEVKFWQREAALLRQQLENLQENHRQMMGEELSGLNVKDLQNLEKQLEMSLRGVRMRKDQIMIDEVQELNQKGNLSHQENMELYKKLD 171
                     67899********************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.483161IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-38160IPR002100Transcription factor, MADS-box
CDDcd002659.41E-44277No hitNo description
SuperFamilySSF554558.63E-32276IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-283859IPR002100Transcription factor, MADS-box
PfamPF014863.6E-2785170IPR002487Transcription factor, K-box
PROSITE profilePS5129716.14686176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010440Biological Processstomatal lineage progression
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MGRGKIMIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVIIFSS TSKLYEYSST  60
SMKSVIERYN KAKEETHKLG DPISEVKFWQ REAALLRQQL ENLQENHRQM MGEELSGLNV  120
KDLQNLEKQL EMSLRGVRMR KDQIMIDEVQ ELNQKGNLSH QENMELYKKL DLARQENTEL  180
YKKVYGTRDA NAVSRNAMSS NSLRVNEDPH APLHLQLSQP QQQHYETPGT TKLGLSLH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-20274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-20274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-20274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-20274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J3e-20274173Myocyte-specific enhancer factor 2A
3p57_I3e-20274173Myocyte-specific enhancer factor 2A
3p57_D3e-20274173Myocyte-specific enhancer factor 2A
3p57_C3e-20274173Myocyte-specific enhancer factor 2A
3p57_B3e-20274173Myocyte-specific enhancer factor 2A
3p57_A3e-20274173Myocyte-specific enhancer factor 2A
3kov_J3e-20274173Myocyte-specific enhancer factor 2A
3kov_I3e-20274173Myocyte-specific enhancer factor 2A
3kov_B3e-20274173Myocyte-specific enhancer factor 2A
3kov_A3e-20274173Myocyte-specific enhancer factor 2A
1tqe_S3e-20174174Myocyte-specific enhancer factor 2B
1tqe_R3e-20174174Myocyte-specific enhancer factor 2B
1tqe_Q3e-20174174Myocyte-specific enhancer factor 2B
1tqe_P3e-20174174Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00410DAPTransfer from AT3G57230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755162e-53HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
GenBankHG9754432e-53HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016441570.11e-177PREDICTED: MADS-box transcription factor 23-like
RefseqXP_016441576.11e-177PREDICTED: MADS-box transcription factor 23-like
SwissprotQ6EP491e-112MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLX5DS451e-135X5DS45_COFAR; AGL16
STRINGVIT_18s0001g07900.t011e-131(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6792056
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.12e-90AGAMOUS-like 16