PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016441521.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 243aa    MW: 28225.5 Da    PI: 4.6013
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016441521.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.95.6e-5561331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv++yLk+k++g+++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++v 
  XP_016441521.1   6 LPPGFRFHPTDEELVNYYLKRKIHGQEIEL-DIIPEVDLYKCEPWELAeKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVS 99 
                     79****************************.99**************84335556888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     s +++++g+kktLv+y+grap+g +tdWvmheyrl
  XP_016441521.1 100 S-QNRAIGMKKTLVYYRGRAPQGIRTDWVMHEYRL 133
                     9.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.68E-634157IPR003441NAC domain
PROSITE profilePS5100560.2156157IPR003441NAC domain
PfamPF023652.7E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKIHG QEIELDIIPE VDLYKCEPWE LAEKSFLPSR  60
DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVSS QNRAIGMKKT LVYYRGRAPQ  120
GIRTDWVMHE YRLDDKECDE ISSIQVDSYA LCRVFKKNGV CSEIEELGQP STVPSFEYPL  180
TQSINVHEYE TTSPDVPLAS SSCMEEEEEE KDDSWMQFIT EDAWCSSNSP FQGEEISPLA  240
FTN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-57215711168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009621551.10.0PREDICTED: NAC domain-containing protein 86 isoform X1
RefseqXP_016441521.10.0PREDICTED: NAC domain-containing protein 86-like isoform X1
SwissprotQ9FFI51e-87NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A1S3XNL10.0A0A1S3XNL1_TOBAC; NAC domain-containing protein 86-like isoform X1
STRINGXP_009621551.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46212442
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-129NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]