PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016441482.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 323aa    MW: 36612.2 Da    PI: 5.882
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016441482.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.45.5e-39591581100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rrkCa+dCvlapyfp++++++f n+hklFG+sn++k++++l++  +++am+++++++++ra+dPv G++++i++lq++++  kael+
  XP_016441482.1  59 ACAACKYQRRKCAPDCVLAPYFPHDRQRQFLNAHKLFGVSNITKIIRHLDQPLKDEAMRTIIFQSDVRANDPVGGCYRIIRDLQRHIDYCKAELD 153
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                      + ++
  XP_016441482.1 154 IVLHQ 158
                     88776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.19858159IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-3659154IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MQNQMTTIST PIPNHPHTIH TTFTTANNLN HNYSTKRVNN NNNNNNKNVL LRVNGAGQAC  60
AACKYQRRKC APDCVLAPYF PHDRQRQFLN AHKLFGVSNI TKIIRHLDQP LKDEAMRTII  120
FQSDVRANDP VGGCYRIIRD LQRHIDYCKA ELDIVLHQLA YCRAQAVAAA ASEQQILADH  180
HATEESFNDN NCDGVVNQAD PLVNNNASSY DQQTVDYHPH SYYNHTSCQK GEDDQQYDEI  240
QDGQLDLADI NFPWSLHEQE STSTSAPNSL MKQLSVYDQC DNIKPILEGI SGFGEEGLSF  300
EHDQAFDQHS YSTREHSPIE GRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-27551537105LOB family transfactor Ramosa2.1
5ly0_B8e-27551537105LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755181e-178HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016441482.10.0PREDICTED: LOB domain-containing protein 22-like
TrEMBLA0A1S3XPA60.0A0A1S3XPA6_TOBAC; LOB domain-containing protein 22-like
STRINGXP_009623735.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA99262126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-52LOB domain-containing protein 22