PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016441061.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 360aa    MW: 40263.6 Da    PI: 8.3317
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016441061.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.57e-42149225278
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     CqvegC+ dl++akeyhrrh++Ce+hsk+p+v+v+g+e+rfCqqCsrfhelsefD++krsCrr+L++hn+rrr++q+
  XP_016441061.1 149 CQVEGCNLDLTSAKEYHRRHRICEAHSKSPMVIVAGMERRFCQQCSRFHELSEFDDNKRSCRRKLSDHNARRRRSQP 225
                     **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.4E-35144210IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.573146223IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.62E-39147227IPR004333Transcription factor, SBP-box
PfamPF031101.2E-32149222IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MDWNMKSHQL EWGWDNNISI CSCSGLEFCR HAETFINEKE VNKAENIKHI YSVVDRFSSY  60
SLDHGSSVKS SAEESNYGIV GSVPGFVSAE RKEKYSTSGT CTRPGESSIG LNLCPANNET  120
VTNYPVLPLS STTAKRCRGS YHLMQNPYCQ VEGCNLDLTS AKEYHRRHRI CEAHSKSPMV  180
IVAGMERRFC QQCSRFHELS EFDDNKRSCR RKLSDHNARR RRSQPEANHF SSTGRPSSFH  240
DQQSRTSGSL SGSSSSTSNS MGKSSCRPKN IRGLNTSTSD YKLDAASNLP RRAHSLLSRN  300
SLGLYDPTHT SMEQLIMPAS VGESQPFVPV TPNWQQVSSE HFPADHQVPF YSPHCFNGSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-271492221184squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1209221RRKLSDHNARRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009780510.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_016441061.10.0PREDICTED: squamosa promoter-binding-like protein 12
TrEMBLA0A1S3XM940.0A0A1S3XM94_TOBAC; squamosa promoter-binding-like protein 12
TrEMBLA0A1U7X2200.0A0A1U7X220_NICSY; squamosa promoter-binding-like protein 12
STRINGXP_009780510.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA136441216
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.38e-41squamosa promoter binding protein-like 2