PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016440235.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 644aa    MW: 72622.9 Da    PI: 6.6761
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016440235.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.17.2e-093974341954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  XP_016440235.1 397 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 434
                     554459******************************88 PP

2BELL113.98.7e-37260328472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     elqk+k+kLl++leeVd+rYk+y++q+++v+s Feavag g+a++Y +lA+ka+SrhFrcL+d i++qi
  XP_016440235.1 260 ELQKRKSKLLQMLEEVDRRYKHYCDQMKAVVSTFEAVAGNGAARVYSTLASKAMSRHFRCLRDGIVGQI 328
                     89*****************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.0E-57195326IPR006563POX domain
PfamPF075262.2E-45201324IPR006563POX domain
PROSITE profilePS5007112.082375438IPR001356Homeobox domain
SMARTSM003895.8E-9378442IPR001356Homeobox domain
CDDcd000863.19E-11378439No hitNo description
SuperFamilySSF466895.13E-17379444IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-27381444IPR009057Homeodomain-like
PfamPF059208.6E-18395434IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MLYVMMAGQE SEEIKPRSMV TTTGYWYSDH TSTPSNNIPN LVNHQLQSFE TNPEIYNLTS  60
GMEMIGFPSN NPQVMWKGNF FNKNSSNTIV GPSSSSSKST NELFYQHGNF TTSENMLVSP  120
TEDQGWNENN RLLVDDPSLR CVFPCEGNER PSQGLSLSLC SSNPSSIGLQ SFELRHQQQQ  180
IIQDGFLGKA AANIQGYYHQ IKDSKYLGPA QELLIEFCSL GTKQNDHSTK VLKQQKSNQW  240
EDENASSSKK QTLHSLDLLE LQKRKSKLLQ MLEEVDRRYK HYCDQMKAVV STFEAVAGNG  300
AARVYSTLAS KAMSRHFRCL RDGIVGQIKA TKKAMGEKDS VIVPGTTRGE TPRLRLLDQT  360
LRQQKAFQQM NMMETHPWRP QRGLPERSVS VLRAWLFEHF LHPYPSDVDK HILARQTGLS  420
RSQVSNWFIN ARVRLWKPMV EEMYLEETKD QQENLESPDG SKGLDHDMNG ISVGRQINQN  480
PQLHIEDQKP NLIRIDSECI SSIINHPEKN DTTNNNNKNC LQDHHQAHNF HSFGRGGDHS  540
FGAIELDFSS YNHNSTGAIA YGNENVQHNV GGGVSLTLGL NQNGGSGMGL STFSQASQSS  600
LFYPRDDHTD QDCQQVQYSL LDSENQNLPY RNLMGAQLLH DLAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-15384442563Homeobox protein Meis2
3k2a_B2e-15384442563Homeobox protein Meis2
4xrm_A2e-15384442563Homeobox protein Meis2
4xrm_B2e-15384442563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4067000.0AF406700.1 Solanum tuberosum BEL1-related homeotic protein 14 (Bel14) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016440234.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_016440235.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-140BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLF6HUM60.0F6HUM6_VITVI; Putative uncharacterized protein
STRINGVIT_02s0025g00200.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-126TALE family protein