PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016439329.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 1000aa    MW: 110868 Da    PI: 7.4521
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016439329.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.11.4e-39151228178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqv++C+adls+ak+yhrrhkvC+vhska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  XP_016439329.1 151 CCQVQDCRADLSNAKDYHRRHKVCDVHSKAAKALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNRRRRKTHP 228
                     6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.8E-31146213IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.035149226IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.24E-37150231IPR004333Transcription factor, SBP-box
PfamPF031101.4E-28152225IPR004333Transcription factor, SBP-box
SuperFamilySSF484033.73E-7771880IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.3E-6774880IPR020683Ankyrin repeat-containing domain
CDDcd002049.06E-8774881No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1000 aa     Download sequence    Send to blast
MDAHNYHGSV SGKKSMEWAS NDWKWDGDLF TAARRNNNSL PSDCCKSKQL MFPIGSEIHP  60
EASRISNCFS SGSDELLTLG SNDKGRKELE KRRRAIVIED DELDHEEEAG SLNLKLGGQL  120
YPVMEGDEEK LEGKSGKKTK IVGVSSNRAV CCQVQDCRAD LSNAKDYHRR HKVCDVHSKA  180
AKALVGNVMQ RFCQQCSRFH VLQEFDEGKR SCRRRLAGHN RRRRKTHPEN VANGASMNDE  240
GGINYLLISL LRILTNVQSN SSDQTKDQDL LSHLMRNLAS LAGATNERNT SGLLSAPPEQ  300
WNAGTSMGAS KEDSLKPTGN CLIPASEVTE KRMGRSDVEY GISQNPCAWQ PDSLCCRKES  360
SPINANASAK VKLNNIDLNN IYDDSQDGNQ KLQNSDASAN PGAASSGCPL WICHDPHKPS  420
PGTSGNSGST SSLSLSNSSG EAQSRTDRIV FKLFGKDPGD FPTALRKQIL DWLSHSPTDI  480
ESYIKPGCII LTIYLRMDKS IWEELYCDLN SSLRKLLNAS ADSFWQTGWV YARVNDRVAF  540
LFNGQVVLDT SLPVKSHRSC GISIVKPIAV CASERVQFLV KGVNLSRPTT RLLCALDGNY  600
LVQGNCIDMM VGADSCMGHE DIQSLSFPCI LPNVTGRGFI EVEDHGLSSN FFPFIVAEKD  660
VCSEIRTLES NIEVAEMAGG FLQGTENLQA RDQALEFLHE MGWLLHRSHL KFRVGSGVNL  720
NLFPFQRFKW LIEFSIDQDW CAVVKKLLDV FFNGIVDVGQ QSSLDIPLWE VGILHQAVRR  780
KCRSMVEVLL KYRPHGAFDK SGPQKQQDDR DYLFRPDAVG PGGLTPLHLV ASLSGFENIL  840
DALIDDPGQV GIEAWKSACD STGLTPNDYA CLRGHYSYIH IVQKKISQKR GDGHVLDIPG  900
SLLDSSIKQK LSDDHRSVKV ASLQTEKSLR KPIQTHCRQC DQKLYYGNSG SSLAIYKPAM  960
LSMVAIAAIC VCVALLFKSS PEVLYSFRPF RWELLKYGSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-291522251184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754440.0HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016439329.10.0PREDICTED: squamosa promoter-binding-like protein 1
TrEMBLA0A1S3XHK10.0A0A1S3XHK1_TOBAC; squamosa promoter-binding-like protein 1
STRINGXP_009793310.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.10.0squamosa promoter-binding protein-like 12