PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016438848.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 605aa    MW: 65505.5 Da    PI: 8.3946
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016438848.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.11.8e-24223267145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  XP_016438848.1 223 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEG 267
                     79****************************************985 PP

2QLQ61.81.9e-21155191137
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     ++FT++Q+++L++Q+l+yKy+ an+P+Pp+Ll +i+k
  XP_016438848.1 155 GPFTPSQWMELEHQALIYKYITANVPIPPYLLNPIRK 191
                     59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.4E-12155191IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088807.2E-16156190IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166624.516156191IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.663223267IPR014977WRC domain
PfamPF088797.2E-21224266IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MDFGVVGGLD NGGVICSDNT SNMFTTAAAA AASVETKQKW YGSTGFHKHE RSSSATTNTT  60
VTEDDWNNKD TKLAKTSDDF SSSKAAAATV LFQQQLRSNC TNSQQMLSFS SPNSQNVTMP  120
YYHYTSTPFT RNSSGCGSGA MNAGNIHGVI AGLKGPFTPS QWMELEHQAL IYKYITANVP  180
IPPYLLNPIR KALESAGFTT FAGLRPNALG WGAFHLGFSN SNDPEPGRCR RTDGKKWRCS  240
RDAVADQKYC ERHMNRGRHR SRKPVEGQTG ATSAKLMNIS SSASAALAPG GAASNTLPLS  300
HPRLSNLLPP AVTNPSTTSP YLERNYTPKE NFGGRYSDTK GLTVVSSSEK ESQYSIQKEQ  360
NLYGVTSRAE FGLVCADSLI NPLNKNSSLV NCRGYGNSED IRDQESKSQH HSLRQFMDDW  420
PKNQSDQSTV SWPDIDLQTD RTQLSISIPV VTSDFMSSTS SPANDKLTTS PQYRPSQEHE  480
TTTQMGLRIG TIISEHNQRQ GNWIPITWET SMGGPLGEVL HSTNNSSGDC KTKSAALNLM  540
TEGWDRSPRM GSSPTGVLQK SSFGSLSNSS AGSSPRAENS KTNEGSSLCN GLLGTTLMNP  600
TLPAM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016438848.10.0PREDICTED: growth-regulating factor 1-like
TrEMBLA0A1S3XG670.0A0A1S3XG67_TOBAC; growth-regulating factor 1-like
STRINGXP_009626682.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16882357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.12e-91growth-regulating factor 1