PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016437615.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 610aa    MW: 65420.4 Da    PI: 8.4082
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016437615.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC789.5e-25237281145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  XP_016437615.1 237 DPEPGRCRRTDGKKWRCSREAVPDQKYCERHINRGRHRSRKPVEG 281
                     79****************************************985 PP

2QLQ60.35.4e-21169204237
             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      FT++Q+++L++Q+l+yK+L+an+PvP++Ll +++k
  XP_016437615.1 169 LFTPSQWMELEHQALIYKHLVANVPVPHQLLIPLKK 204
                     6*******************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.2E-12168204IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.027169204IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.0E-15170202IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.954237281IPR014977WRC domain
PfamPF088793.2E-21238280IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MDFGGVMTME TKQESANNIS KTVNSPAETN NSSKITNGSG QQLKQERSGP CDDTNCRSSK  60
VQRAAADDFS ALCKQMPQQQ GPTTPTLFMR SGSPNNGRGH STMLSFSSPK SEELIPFLST  120
NNASAQDSSK SLAFPLFDSG SHYSRASAYA SGGSNESTRG AFVARFRGLF TPSQWMELEH  180
QALIYKHLVA NVPVPHQLLI PLKKSLNPYA FSGLSSGSYA SNWGWGTFHL GFTGNTDPEP  240
GRCRRTDGKK WRCSREAVPD QKYCERHINR GRHRSRKPVE GQNGHAVSGS TTSKVASVAP  300
SSSATVISSS GTSNSLGAVQ HQFNSLQPSA ANPSTDQLVN RMQDHKGVSM ISPTIGLKPK  360
ASAISIQKQH NGFELSSLSE FGLVSSDSLL NPSQRSSFVN PKNSNAFIDF NDQEQSEQHP  420
VHHFIDGWTK EQSSRASASW PDELKSDWTQ LSMAIPMAAS DFSSSSNSPR QEKLTLSPLR  480
LSRDFDPIQM GLGVTNSHGE PMQKTANWLP VSWENALGGP LGEVLNSTAG NAGDAKNSSA  540
LNLATEMWDS SPPFGSSPTG VLQKSTFVSL SNSSSGGSPR ADSKKVHEGA GMCDEVIGST  600
LASSLCIPSM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016437615.10.0PREDICTED: growth-regulating factor 1-like
TrEMBLA0A1S3XCF00.0A0A1S3XCF0_TOBAC; growth-regulating factor 1-like
STRINGXP_009589483.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16882357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.11e-108growth-regulating factor 1