PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016437290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 175aa    MW: 19446.2 Da    PI: 7.0697
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016437290.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.11.8e-4481071100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasn++k+l++lp ++r da+ssl+yeA+ar+rdPvyG+vg i+ lq+q+++l+ +la
  XP_016437290.1   8 PCASCKLLRRRCAKDCIFAPYFPSDDPQKFAIVHKVFGASNISKMLQELPVNKRADAVSSLAYEANARMRDPVYGCVGAISYLQNQVSRLQMQLA 102
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     l+++e
  XP_016437290.1 103 LAQAE 107
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.5787108IPR004883Lateral organ boundaries, LOB
PfamPF031959.9E-448105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MGAAGNSPCA SCKLLRRRCA KDCIFAPYFP SDDPQKFAIV HKVFGASNIS KMLQELPVNK  60
RADAVSSLAY EANARMRDPV YGCVGAISYL QNQVSRLQMQ LALAQAEILC IQMQSQDHHP  120
ANLLPMSPPI HDQLVAADDE KSFLNLSHYL NNFESHKCNS DISQEGVFLW TGQYL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-4841097112LOB family transfactor Ramosa2.1
5ly0_B7e-4841097112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009764881.11e-129PREDICTED: LOB domain-containing protein 12-like
RefseqXP_016437290.11e-129PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW39e-71LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A1S3XBI31e-128A0A1S3XBI3_TOBAC; LOB domain-containing protein 12-like
TrEMBLA0A1U7VIX61e-128A0A1U7VIX6_NICSY; LOB domain-containing protein 12-like
STRINGXP_009764881.11e-128(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-73LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]